Zea mays: A plant species of the family POACEAE. It is a tall grass grown for its EDIBLE GRAIN, corn, used as food and animal FODDER.Plant Proteins: Proteins found in plants (flowers, herbs, shrubs, trees, etc.). The concept does not include proteins found in vegetables for which VEGETABLE PROTEINS is available.Plant Root Cap: A cone-shaped structure in plants made up of a mass of meristematic cells that covers and protects the tip of a growing root. It is the putative site of gravity sensing in plant roots.Genes, Plant: The functional hereditary units of PLANTS.Plant Roots: The usually underground portions of a plant that serve as support, store food, and through which water and mineral nutrients enter the plant. (From American Heritage Dictionary, 1982; Concise Dictionary of Biology, 1990)Gene Expression Regulation, Plant: Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in plants.Seeds: The encapsulated embryos of flowering plants. They are used as is or for animal feed because of the high content of concentrated nutrients like starches, proteins, and fats. Rapeseed, cottonseed, and sunflower seed are also produced for the oils (fats) they yield.Plant Leaves: Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)Gravitropism: The directional growth of organisms in response to gravity. In plants, the main root is positively gravitropic (growing downwards) and a main stem is negatively gravitropic (growing upwards), irrespective of the positions in which they are placed. Plant gravitropism is thought to be controlled by auxin (AUXINS), a plant growth substance. (From Concise Dictionary of Biology, 1990)Zein: A group of alcohol-soluble seed storage proteins from the endosperm of corn.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.DNA, Plant: Deoxyribonucleic acid that makes up the genetic material of plants.Plant Shoots: New immature growth of a plant including stem, leaves, tips of branches, and SEEDLINGS.Genome, Plant: The genetic complement of a plant (PLANTS) as represented in its DNA.Indoleacetic Acids: Acetic acid derivatives of the heterocyclic compound indole. (Merck Index, 11th ed)Pyruvate, Orthophosphate Dikinase: An enzyme that catalyzes the reaction of ATP, pyruvate, and orthophosphate to form AMP plus phosphoenolpyruvate plus pyrophosphate. EC 2.7.9.1.Chromosomes, Plant: Complex nucleoprotein structures which contain the genomic DNA and are part of the CELL NUCLEUS of PLANTS.Zearalenone: (S-(E))-3,4,5,6,8,10-Hexahydro-14,16-dihydroxy-3-methyl-1H-2-benzoxacyclotetradecin-1,7(8H)-dione. One of a group of compounds known under the general designation of resorcylic acid lactones. Cis, trans, dextro and levo forms have been isolated from the fungus Gibberella zeae (formerly Fusarium graminearum). They have estrogenic activity, cause toxicity in livestock as feed contaminant, and have been used as anabolic or estrogen substitutes.Endosperm: Nutritive tissue of the seeds of flowering plants that surrounds the EMBRYOS. It is produced by a parallel process of fertilization in which a second male gamete from the pollen grain fuses with two female nuclei within the embryo sac. The endosperm varies in ploidy and contains reserves of starch, oils, and proteins, making it an important source of human nutrition.RNA, Plant: Ribonucleic acid in plants having regulatory and catalytic roles as well as involvement in protein synthesis.Plants, Genetically Modified: PLANTS, or their progeny, whose GENOME has been altered by GENETIC ENGINEERING.Plants: Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.Pollen: The fertilizing element of plants that contains the male GAMETOPHYTES.Crops, Agricultural: Cultivated plants or agricultural produce such as grain, vegetables, or fruit. (From American Heritage Dictionary, 1982)Seedling: Very young plant after GERMINATION of SEEDS.Plant Growth Regulators: Any of the hormones produced naturally in plants and active in controlling growth and other functions. There are three primary classes: auxins, cytokinins, and gibberellins.Cotyledon: A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)Anthocyanins: A group of FLAVONOIDS derived from FLAVONOLS, which lack the ketone oxygen at the 4-position. They are glycosylated versions of cyanidin, pelargonidin or delphinidin. The conjugated bonds result in blue, red, and purple colors in flowers of plants.Gravity Sensing: Process whereby a cell, bodily structure, or organism (animal or plant) receives or detects a gravity stimulus. Gravity sensing plays an important role in the directional growth and development of an organism (GRAVITROPISM).Soil: The unconsolidated mineral or organic matter on the surface of the earth that serves as a natural medium for the growth of land plants.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Oryza sativa: Annual cereal grass of the family POACEAE and its edible starchy grain, rice, which is the staple food of roughly one-half of the world's population.Inbreeding: The mating of plants or non-human animals which are closely related genetically.Poaceae: A large family of narrow-leaved herbaceous grasses of the order Cyperales, subclass Commelinidae, class Liliopsida (monocotyledons). Food grains (EDIBLE GRAIN) come from members of this family. RHINITIS, ALLERGIC, SEASONAL can be induced by POLLEN of many of the grasses.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Abscisic Acid: Abscission-accelerating plant growth substance isolated from young cotton fruit, leaves of sycamore, birch, and other plants, and from potatoes, lemons, avocados, and other fruits.Starch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Humic Substances: Organic matter in a state of advanced decay, after passing through the stages of COMPOST and PEAT and before becoming lignite (COAL). It is composed of a heterogenous mixture of compounds including phenolic radicals and acids that polymerize and are not easily separated nor analyzed. (E.A. Ghabbour & G. Davies, eds. Humic Substances, 2001).Phthalimides: The imide of phthalic acids.Gravitation: Acceleration produced by the mutual attraction of two masses, and of magnitude inversely proportional to the square of the distance between the two centers of mass. It is also the force imparted by the earth, moon, or a planet to an object near its surface. (From NASA Thesaurus, 1988)Chloroplasts: Plant cell inclusion bodies that contain the photosynthetic pigment CHLOROPHYLL, which is associated with the membrane of THYLAKOIDS. Chloroplasts occur in cells of leaves and young stems of plants. They are also found in some forms of PHYTOPLANKTON such as HAPTOPHYTA; DINOFLAGELLATES; DIATOMS; and CRYPTOPHYTA.DNA Transposable Elements: Discrete segments of DNA which can excise and reintegrate to another site in the genome. Most are inactive, i.e., have not been found to exist outside the integrated state. DNA transposable elements include bacterial IS (insertion sequence) elements, Tn elements, the maize controlling elements Ac and Ds, Drosophila P, gypsy, and pogo elements, the human Tigger elements and the Tc and mariner elements which are found throughout the animal kingdom.Herbicides: Pesticides used to destroy unwanted vegetation, especially various types of weeds, grasses (POACEAE), and woody plants. Some plants develop HERBICIDE RESISTANCE.

*  Thai Agricultural Research Repository: On-farm research on corn during 1977
on to:. Receive email updates. My DSpace authorized users ... Keywords: corn maize on farm research variety trials ... F04 H60. AGROVOC: Zea mays Maize On-farm research Variety...
http://anchan.lib.ku.ac.th/agnet/handle/001/3939
*  Constraints to On-Farm Maize (Zea mays L.) Seed Production in Western Kenya: Plant Growth and Yield
to On-Farm Maize Zea mays L. Seed Production in Western ... constraints to on farm maize zea mays l seed production in western kenya plant growth and yield table table preferences of farmers for varieties and their attributes attribute percent of farmers local landraces...
http://hindawi.com/journals/isrn/2012/153412/tab3/
*  Griffith University | Griffith Research Online | Statistics for "Zea mays annexins modulate cytosoli
Statistics for "Zea mays annexins modulate cytosolic free ... Statistics for "Zea mays annexins modulate cytosolic free ... Statistics for "Zea mays annexins modulate cytosolic free...
http://www98.griffith.edu.au/dspace/statistics?itemid=28525
*  KEGG T01088: 100285641
T01088: 100285641. Zea mays maize : 100285641. Entry ... II. Organism zma Zea mays maize. Pathway zma00564. ... Zea mays maize : 100285641. Entry 100285641 CDS T01088. Definition RefSeq acyl-protein thioesterase 1 EC:3.1.1.5. KO K06130. lysophospholipase II. Organism zma Zea mays maize. Pathway zma00564. Glycerophospholipid metabolism. Brite KEGG Orthology KO Metabolism Lipid metabolism 00564 Glycerophospholipid metabolism 100285641 Enzymes 3. Hydrolases 3.1 Acting on ester bonds 3.1.1 Carboxylic-ester hydrolases 3.1.1.5 lysophospholipase 100285641. SSDB. Motif Pfam: Abhydrolase 2 Hydrolase 4 Abhydrolase 5 DLH Peptidase S9 Abhydrolase 3 FSH1 AXE1 Abhydrolase 6. Other DBs NCBI-ProteinID: NP 001152004 NCBI-GeneID: 100285641 UniProt: B6U7L3. Position 2. AA seq 264 aa. MSSLIRLLFTLAAAIGAASLLVASLRRRAPPPGLPAKLVPSSHMAGRNRSFVLWLHGLGD SGPANEPIRNLFSAPEFRLAKWSFPSAPRAPVSCNNGFVMPSWFDIHELPMSAGSPQDET GVLKAVEKVHAMIDREVADGIHPENIFVCGFSQGGALTLASVLLYPKKLGGGAVFSGWVP FSSSVTERISPEANKTPFLWSHGMADKVVLFEAGQAGPPFLQSAGVNCEFKAYPDLG...
http://genome.jp/dbget-bin/www_bget?zma:100285641
*  KEGG T01088: 100283183
Zea mays maize : 100283183. Entry 100283183 CDS ... Organism zma Zea mays maize. Pathway zma00030. Pentose ... EMBL 2. Protein domain 2. Pfam 2. All databases 28 Download...
http://genome.jp/dbget-bin/www_bget?zma:100283183
*  KEGG T01088: 100285340
T01088: 100285340. Zea mays maize : 100285340. Entry 100285340 ... Organism zma Zea mays maize. Pathway zma00270. Cysteine and ... EMBL 1. Protein domain 8. Pfam 8. All databases 35 Download...
http://genome.jp/dbget-bin/www_bget?zma:100285340
*  PpGDB Phypa1.1 gene models (JGI-cosmoss):
That username or email is already registered, or you have ... password This email address is invalid or already in use ... choose another. email Please supply an account name. name ... Vitis vinifera. Zea mays. EST Assemb. -Overview -. ... Vitis vinifera. Zea mays. GSS Assemb. FTP Server. ... PpGDB Phypa1.1 gene models JGI-cosmoss :. That username or email is already registered, or you have forgotten to enter a required field. Please try again. This username is invalid or already in use. Please choose another. user name This password is invalid. Please choose another. password This email address is invalid or already in use. Please choose another. email Please supply an account name. Anonymous Login Authenticating Login. Unrecognized User/Password combination. Username: Password: Stay logged in until I: close my browser am inactive for a day click logout. Login Forgot username / password. Help. Search Options... PlantGDB Site Search Sequence ID Sequence Keyword. at PlantGDB. Home. Sequenc...
http://plantgdb.org/PpGDB/cgi-bin/getRecord.pl?dbid=0&resid=4&gsegUID=5003
*  Sothys - Iris and Litchi Escape Scented Body Lotion
carbonate, Zea mays Corn germ oil, Betaine, ... Sothys - Iris and Litchi Escape Scented Body Lotion. Home Shop by Brands SOTHYS Hydra Nourishing Body Elixirs. This scented lotion offers the same therapeutic extracts of Iris and Litchi as the professional spa Body Event Treatment. Ingredients: Aqua Water , Glycerin, Dicaprylyl carbonate, Zea mays Corn germ oil, Betaine, Cyclopentasiloxane, Parfum Fragrance , Olea europaea Olive oil unsaponifiables, Butylene glycol, Carbomer, Glycine soja Soybean oil unsaponifiables, Triticum vulgare Wheat germ oil unsaponifiables, Chlorphenesin, Acrylamide/Sodium acryloyldimethyltaurate copolymer, Xanthan gum, Acrylates/C10-30 Alkyl acrylate crosspolymer, Sodium benzoate, Sodium hydroxide, C13-14 isoparaffin, Sodium dehydroacetate, Tetrasodium EDTA, Linalool, Hydroxycitronellal, Limonene, Citronellol, Pollen extract, Tocopherol, Hydroxyisohexyl 3-cyclohexene carboxaldehyde, Biosaccharide gum-1, Hexyl cinnamal, Laureth-7, Alpha-Isomethyl ionone, Geraniol, Glyceryl caprylate, S...
http://beautybridge.com/soirandliess.html
*  Zea mays (maize) leaf infected with Ustilago maydis | 2007 Photomicrography Competition | Nikon’s
zea mays maize leaf infected with ustilago maydis ... subject matter zea mays maize leaf infected with...
http://nikonsmallworld.com/galleries/entry/2007-photomicrography-competition/47
*  Zea Mays Starch
Zea Mays Starch. Zea Mays Starch. Tightly Curly Method. ... R S T U V W X Y Z. Zea Mays Starch aka Corn Starch; Starch...
http://tightlycurly.com/ingredients/zea_mays_starch
*  Corn Cob Meal, Corn Cob Meal Suppliers and Manufacturers at Alibaba.com
... Source Products Suppliers. For Suppliers. Help Center for Suppliers. Related Searches for corn cob meal :. palm kernel meal sesame meal sesame seed meal iqf baby corn cobs sweet corn cob products corn cob for animal bedding corn cob ce ce corn cob e27 corn cob e40 corn cob 60w corn cob b22 corn cob corn cob e27 corn cob 80w e39 corn cob More... corn. corn cob meal 1,128 Results. Minimum Order:. Compare. Order. Contact Supplier. Tags: Corn Cob Meal. Compare. Corn Cob Meal THAI ALL TRADE LIMITED PARTNERSHIP US $177-180 100 Metric Tons Min. Order. Contact Supplier. Tags: Corn Meal Feed. Compare. Hot sale corn cob meal Dalian Holy Trading Co., Ltd. US $199-299 25 Tons Min. Order. Contact Supplier. Tags: Corn Cob Meal. Compare. BEST PRICE CORN COB MEAL VIET NAM HOMEMART SERVICES TRADING COMPANY LIMITED US $145-165 24 Metric Tons Min. Order. Contact Supplier. Tags: Corn Cob Meal. Corn Meal. Corn Powder. Compare. Choline chloride 50% 60% corn cob meal Cangzhou Huayou Import Export Trade Co., Ltd. US $650-850 16...
http://alibaba.com/showroom/corn-cob-meal.html
*  Southern corn leaf blight
... 'Southern corn leaf blight' SCLB is a fungal disease of maize caused by the plant pathogen ' Bipolaris maydis ' also known as ' Cochliobolus heterostrophus ' in its teleomorph state. maydis': Race O, Race C, and Race T; SCLB symptoms vary depending on the infectious pathogen's race. Race T is infectious to corn plants with the Texas male sterile cytoplasm cms-T cytoplasm maize and this vulnerability was the cause of the United States SCLB epidemic of 1969-1970 1 Ullstrup, A. The primary host for Southern corn leaf blight is 'Zea mays', or maize, known as corn in the United States. Various types of corn with normal cytoplasm N, while vulnerable to Race O, have cytoplasmic resistance to the T-toxin of 'Bipolaris maydis' produced by Race T. This resistance owes itself to the absence of a gene found only in plants with Texas male sterile cytoplasm. Race O / O-toxin. Maize with normal cytoplasm N - most maize plants. Race T / T-toxin. Maize with Texas male sterile cytoplasm T-cms - these plants have gene T-ur...
https://en.wikipedia.org/wiki/Southern_corn_leaf_blight
*  Zea mays - Ensembl Genomes
... Ensembl Genomes. Ensembl Bacteria. Ensembl Protists. Ensembl Fungi. Ensembl Plants. Ensembl Metazoa. Ensembl vertebrates. Help. Search terms. Search Zea mays. Search Ensembl Plants. Search Ensembl genomes. Search all species. Search EBI. Zea. Zea mays. Arabidopsis lyrata. Arabidopsis thaliana. Oryza barthii. Oryza glaberrima. Oryza glumaepatula. Oryza rufipogon. Oryza sativa Indica. Oryza sativa Japonica. Setaria italica. Sorghum bicolor. Zea mays Recent locations Clear history. Zea mays Zea mays Data Source MaizeSequence.org. About Zea mays. Zea mays maize has the highest world-wide production of all grain crops, yielding 875 million tonnes in 2012 http://faostat.fao.org/. In addition to its economic value, maize is an important model organism for studies in plant genetics, physiology, and development. More information and statistics. Example region Genome assembly: AGPv3 More information and statistics Download DNA sequence FASTA Convert your data to AGPv3 coordinates Display your data in Ensembl Plant...
http://plants.ensembl.org/Zea_mays/Info/Index
*  Sweet corn
thumb|200px|Husked sweet corn thumb|200px|Loose kernels of sweet corn. Cultivars Genetics. thumb|200px|Young sweet corn Open pollinated cultivar s of white sweet corn started to become widely available in the United States in the 19th century. 'su' normal sugary 'se' sugary enhanced, originally called Everlasting Heritage 'sh2' shrunken-2. The fruit of the sweet corn plant is the corn 'kernel', a type of fruit called a caryopsis. Corn on the cob is a sweet corn cob that has been boiled, steamed, or grilled whole; the kernels are then eaten directly off the cob or cut off. After further investigation Laughnan discovered that the endosperm of 'sh2' sweet corn kernels store less starch and from 4 to 10 times more sugar than normal 'su' sweet corn. was the first seed company to release a supersweet corn and it was called 'Illini Xtra Sweet', but widespread use of supersweet hybrids did not occur until the early 1980s. thumb|200px|Cut White Sweet Corn The third gene mutation to be discovered is the 'se' or "sugary...
https://en.wikipedia.org/wiki/Sweet_corn
*  ARS Project: Compositional analysis and metabolic profiling on diverse maize lines and land races (4
ARS Project: Compositional analysis and metabolic profiling on diverse maize lines and land races 423818 Plant Genetics Research : Research. Diverse Maize Research. Research Project: Compositional analysis and metabolic profiling on diverse maize lines and land races. Allelic diversity in the genes underlying seed composition has changed dramatically as a result of artificial selection during domestication and breeding, leading to the modern hybrids of today. In order to identify genes underlying kernel composition and to continue to improve kernel traits in maize, we must realize the full range of variation for these traits in maize. Many studies have been conducted to investigate small numbers of composition traits in narrow samples of maize germplasm. Here we propose to conduct a very thorough analysis of grain composition and metabolites in a set of hybrids representing the range of domesticated maize. The formal objective of this project is to investigate the natural variability of composition traits and...
http://ars.usda.gov/research/projects/projects.htm?accn_no=423818
*  Growth Stages of Sweet Corn | Garden Guides
Growth Stages of Sweet Corn. Plants. About Plants. Other Plants. Gardening Calendar. Plants. Planting & Growing Vegetables. Growth Stages of Sweet Corn. Growth Stages of Sweet Corn Comments. Overview Sweet corn goes through a very specific process of growth, beginning with vegetative growth, known as the 'V' stages, and completing with reproduction, referred to as the 'R' stages. Each stage is critical to the proper development of the plant and the formation of the corn itself; proper care during each stage can help optimize production. This will eventually grow into the stalk of the corn plant. V1-V n Vegetative Growth About a week after the coleoptile emerges, the root system continues its growth. The plant also begins to form the silks that will eventually emerge in the reproductive phase. VT Tassel Emergence In the VT stage, the male reproductive portion of the plant, the tassel, will emerge. R1 Silking The R1 stage represents the beginning of the reproductive phase of sweet corn plants and usually occurs...
http://gardenguides.com/88496-growth-stages-sweet-corn.html
*  Patent US7829769 - Inbred corn line XHH12 - Google Patents
An inbred corn line, designated XHH12, the plants and seeds of the inbred corn line XHH12, methods for producing a corn plant, either inbred or hybrid, produced by crossing the inbred corn line XHH12 with itself or with another corn plant, and hybrid corn seeds and plants produced by crossing the inbred... Inbred corn line XHH12 US 7829769 B1 Abstract An inbred corn line, designated XHH12, the plants and seeds of the inbred corn line XHH12, methods for producing a corn plant, either inbred or hybrid, produced by crossing the inbred corn line XHH12 with itself or with another corn plant, and hybrid corn seeds and plants produced by crossing the inbred line XHH12 with another corn line or plant and to methods for producing a corn plant containing in its genetic material one or more transgenes and to the transgenic corn plants produced by that method. This invention also relates to inbred corn lines derived from inbred corn line XHH12, to methods for producing other inbred corn lines derived from inbred corn lin...
http://google.com/patents/US7829769?ie=ISO-8859-1
*  .. Sweet Corn = Summer Sunshine! Easy, Delicious, and Fresh – How to Cook Fresh Sweet Corn and R
Sweet Corn = Summer Sunshine. Easy, Delicious, and Fresh – How to Cook Fresh Sweet Corn and Recipe for Corn Chowder. Fresh. Sunshine. Sweet. Delicious. Summer. What do you think of when you think of sweet corn.  It’s so easy to cook and makes any meal a summer feast. How do you cook your sweet corn.  Delicious and easy. Today, I tried corn chowder for the first time.  The recipe is from Sunshine Sweet Corn.  It’s a great website for info about corn, recipes, and cooking tips. Classic Fresh Corn Chowder. Prep:  15 minutes Cook:  20 minutes. 3 large ears supersweet Corn 2 tablespoons butter 1-¼ cups diced onion 2/3 cup diced celery ½ teaspoon minced garlic 2 cans 13-¾ ounces each ready-to-serve lower-sodium chicken broth 3 tablespoons flour 1 cup half and half Cut corn kernels off cobs makes about 2 cups *; set aside kernels and cobs. In a large saucepan, over medium heat, melt butter. Add onion and celery; cook and stir until tender, about 5 minutes. Add garlic; cook until aromatic, about 30 seconds...
http://kellysluckyyou.com/sweet-corn-summer-sunshine-easy-delicious-and-fresh-how-to-cook-fresh-sweet-corn-and-recipe-for-corn-chowder/
*  Sweet Corn Soup Vegetarian Recipe | FoodFood | Sanjeev Kapoor Kitchen by Master Chef Sanjeev Kapoor
Sweet Corn Soup Vegetarian Recipe. Sanjeev Kapoor Kitchen by Master Chef Sanjeev Kapoor. Kitchen Appliances Appliances. Google+. Wordpress. YouTube. Chef Sanjeev Kapoor. Media Coverage. Invite As Speaker. Our Culture. Job Openings. Recipes. Home » FoodFood » Sanjeev Kapoor Kitchen » Sweet Corn Soup Sweet Corn Soup  Recipe Saneev Kapoor. Sweet corn and vegetable soup - totally wholesome. This recipe is from FoodFood TV channel & has featured on Sanjeev Kapoor Kitchen. Preparation Time : 11-15 minutes Cooking time : 11-15 minutes Servings : 4. हिन्दी में पढ़ें Main Ingredients Sweet corn kernels,boiled, Sweet corn cream style Cuisine Chinese Course Soup Level Of Cooking Medium. Email. Ingredients Sweet corn kernels,boiled 1/2 cup Sweet corn cream style 2 cups Oil 1 tablespoon Cabbage 1/4 small Carrot, finely chopped 1/4 medium Vegetable stock 4 cups White pepper powder 1/2 teaspoon Salt to taste Cornflour/ corn starch 3 tablespoons. Grate cabbage and add to the hot oil. Add carrot and sauté on high heat for ...
http://sanjeevkapoor.com/recipe/Sweet-Corn-Soup-Sanjeev-Kapoor-Kitchen-FoodFood.html
*  Corn kernel
thumb|Bulk corn kernels thumb|Kernels on the cob Image:CSIRO ScienceImage 3195 Maize or corn.jpg. 'Corn kernels' are the seeds of maize. Though technically a grain, maize kernels are used in cooking as a vegetable or starch. One ear of corn contains roughly 800 kernels in 16 rows. One hundred bushels of corn can contain upwards of 7,280,000 kernels. Corn is a popular food throughout the world in many forms; it is used in breakfast cereals in the Western world as corn flakes and it is a grain that can be eaten raw off the cob, although it is usually preferred cooked. In the United States, for economic reasons such as government subsidies, corn is the basis of many products, in the form of high fructose corn syrup, in favor of cane sugar. thumb|left|Maize kernels The kernel of maize has a pericarp of the fruit fused with the seed coat referred to as " caryopsis ", typical of the grasses, and the entire kernel is often referred to as the " seed ". The kernels are about the size of pea s, and adhere in regular ro...
https://en.wikipedia.org/wiki/Corn_kernel
*  PLANTS AND SEEDS OF HYBRID CORN VARIETY CH027859 - Patent application
The seed of claim 10, wherein the single locus conversion confers a trait selected from the group consisting of male sterility, herbicide tolerance, insect resistance, disease resistance, waxy starch, modified fatty acid metabolism, modified phytic acid metabolism, modified carbohydrate metabolism and modified protein metabolism. The method of claim 17, further comprising repeating steps a - f at least once to introduce at least a second trait into hybrid corn variety CH027859, wherein the second trait is selected from the group consisting of male sterility, herbicide tolerance, insect resistance, disease resistance, waxy starch, modified fatty acid metabolism, modified phytic acid metabolism, modified carbohydrate metabolism and modified protein metabolism. The method of claim 20, further comprising repeating steps a and b at least once to introduce at least a second trait into hybrid corn variety CH027859, wherein the second trait is selected from the group consisting of male sterility, herbicide tolerance,...
http://faqs.org/patents/app/20090282551
*  White Bean Chili With Chicken, Corn Kernels Recipe | Group Recipes
White Bean Chili With Chicken, Corn Kernels Recipe. Group Recipes. Categories. Search. Your Bookmarks. Upload a Recipe. Join. Login. Onion Sauce... For Your Hotdogs 1 hour ago ... Search Inspiration. No idea what to search for. Start browsing till you find something. onion rice recipe. ground turkey breast recipes. custard bun recipe. butter muffin recipe. 12 layer jello. italian christmas cookie rolled and sliced. pasta with oil butter and garlic sauce. home made cakes. olive dip. Home White Bean Chili With Chicken, Corn Kernels Recipe. Top Recipes. Newest. White Bean Chili Recipes. 4 recipes to browse. Filtered by. chicken. corn kernels. . Search. by. White Bean Soup With Ham. ham beans soup greens. 6 comments 17 bookmarks. by. White Chicken Chili. white chicken chili lime cumin spicy zesty. 10 comments 20 bookmarks. by. Black And White Bean Chicken Chili. chicken black beans cannellini spicy. 1 comments 1 bookmarks. by. Corn And White Bean Soup. ham corn navy beans chicken broth green chiles. 0 comments 1 ...
http://grouprecipes.com/white-bean-chili/ingredients:chicken,corn-kernels
*  Breeding investigations of maize (Zea mays L.) genotypes for tolerance to low nitrogen and drought i
Breeding investigations of maize Zea mays L. genotypes for tolerance to low nitrogen and drought in Zambia. . Breeding investigations of maize Zea mays L. genotypes for tolerance to low nitrogen and drought in Zambia. UKZN ResearchSpace. Login. University of KwaZulu-Natal ResearchSpace. →. College of Agriculture, Engineering and Science. →. School of Agricultural, Earth and Environmental Sciences. →. Plant Breeding. →. Doctoral Degrees Plant Breeding. → View Item. JavaScript is disabled for your browser. Some features of this site may not work without it. Breeding investigations of maize Zea mays L. genotypes for tolerance to low nitrogen and drought in Zambia. URI:. http://hdl.handle.net/10413/2165. Date: 2007. Abstract:. Low soil nitrogen N and drought impede maize production in the small-scale farming sector in Zambia; and adoption of new cultivars with improved tolerance might enhance production. This study: a assessed farmer preferences for maize cultivars; b determined ...
http://researchspace.ukzn.ac.za/xmlui/handle/10413/2165
*  Northern Leaf Blight Threatens Georgia Corn | Corn content from Corn and Soybean Digest
Northern Leaf Blight Threatens Georgia Corn. Corn content from Corn and Soybean Digest. Corn and Soybean Digest. Advertisement. Home > Corn > Northern Leaf Blight Threatens Georgia Corn. Northern Leaf Blight Threatens Georgia Corn. Mar 19, 2010 Source: Farm Press. Corn+Soybean Digest. Soybean Diseases,. Advertisement. He says southern rust has been a concern for a number of years, especially in hybrids with little or no resistance. Northern corn leaf blight is the newest corn disease threat, according to Kemerait. Southern rust has been the No. 1 disease on Georgia corn until last year. Though many corn hybrids have good resistance to southern rust, a new race of the disease showed up in 2008 that successfully attacked the resistant hybrids. Last year, northern corn leaf blight overtook southern rust as the primary corn disease threat in Georgia. “I can almost guarantee that northern corn leaf blight will be a problem in 2010,” says Kemerait. “Corn prices and the yield potential of your crop will dete...
http://cornandsoybeandigest.com/corn/northern-leaf-blight-threatens-georgia-corn
*  ARS | Publication request: Genomic predictability of interconnected bi-parental maize populations Pl
Publication request: Genomic predictability of interconnected bi-parental maize populations Plant, Soil and Nutrition Research : Research. Location: Plant, Soil and Nutrition Research. Title: Genomic predictability of interconnected bi-parental maize populations Authors. Genomic predictability of interconnected bi-parental maize populations. Interpretive Summary: In plant breeding populations there are often groups of individuals who are more closely to each other than they are to individuals outside their group. Prediction accuracies declined strongly if siblings shared only one parent half-sibs, but better results could be achieved if the TP contained half-sibs related through both instead of only one parent. Adding unrelated individuals to the TP resulted in negative or reduced predication accuracies. Knowing the predictability for progeny from individual crosses with such a TP represents a key element for implementing genomic prediction in plant breeding. populations of doubled haploid DH lines derived fr...
http://ars.usda.gov/research/publications/publications.htm?seq_no_115=295606
*  Manage Corn Plants’ Nitrogen Needs | Hoards Dairyman
Manage Corn Plants’ Nitrogen Needs. Hoards Dairyman. Manage Corn Plants’ Nitrogen Needs. Manage Corn Plants’ Nitrogen Needs. Modern Hybrids Need Season-Long N from Soil. New research by DuPont Pioneer and university scientists into nitrogen N use by corn plants may change the way growers think about N management practices. “Because of the importance of N uptake prior to flowering, when yield potential is first set, corn growers have traditionally targeted N availability to this period," says Jason DeBruin, DuPont Pioneer research scientist. In fact, modern hybrids have very different patterns of N uptake compared to older hybrids – less of their total N supply is taken up early, and more is extracted during reproductive development. “Studies from 20121 and 20132 showed that new hybrids took up 29 percent and 40 percent more N post-flowering, respectively, than older hybrids," explains DeBruin. DuPont Pioneer will release EncircaSM Yield later this year to help growers more effectively manage critical crop pro...
http://hoards.com/IB_Manage_Corn_Plants_Nitrogen_Needs
*  Corn steep liquor
... is a by product of corn wet milling liggett w and koffler h corn steep liquor in microbiology bacteriol rev december a viscous concentrate of corn solubles which contains amino acids vitamins and minerals it is an important constituent of some growth media it was used in the culturing of penicillium during research into penicillin by american microbiologist andrew j moyer penicillin comes to peoria american history august it is an excellent source of organic nitrogen liggett w and koffler h corn steep liquor in microbiology bacteriol rev december corn steep liquor has cas number and ec number references category maize products...
https://en.wikipedia.org/wiki/Corn_steep_liquor
*  Abstract: Doubled Haploids in Tropical Maize: Influence of Inducer, Donor, and Induction Environment
... On In Vivo Haploid Induction Rates. Author Index /AnMtgsAbsts2009.52337 Doubled Haploids in Tropical Maize: Influence of Inducer, Donor, and Induction Environment On In Vivo Haploid Induction Rates. Reliable haploid induction rates HIR are of utmost importance when employing inducer genotypes for maize doubled haploid DH line development using the in vivo haploid induction technique.This work investigates the influence of the genetic constitution of inducers and donors as well as of the environmental conditions on HIR. In a first experiment, we compared HIR of three temperate inducer genotypes in subtropical and tropical environments in Mexico using a temperate liguleless tester as female parent. HIR were calculated by dividing the number of haploid plants/seeds by the total number of plants/seeds. Mean HIR was 14.9% 7.9-17.8% using the temperate liguleless donor, but was only 4.8% 0-19.7% using the tropical donors. Inducers and donors both had a significant influence on HIR. However, no significant diff...
https://a-c-s.confex.com/crops/2009am/webprogram/Paper52337.html
*  Drought-stressed corn concerns | Corn content from Delta Farm Press
Drought-stressed corn concerns. Corn content from Delta Farm Press. Skip to Navigation Skip to Content Delta Farm Press. Home > Corn > Drought-stressed corn concerns Drought-stressed corn concerns Jul 6, 2012 Debra Levey Larson, University of Illinois. 0 If corn plants have green active tissue, the plant may recover and produce more plant dry matter or yield per acre if rain arrives. If the corn plant has not pollinated, the quality of the corn silage will be reduced, but the plant may continue to store nutrients if green. Corn plants are firing drying from the roots up the stalk of the corn plant, Hutjens said. Hutjens said the following strategies can be considered: If corn plants have green active tissue, the plant may recover and produce more plant dry matter or yield per acre if rain arrives. If the corn plant has not pollinated, the quality of the corn silage will be reduced, but the plant may continue to store nutrients if green. Drought-stressed corn can be high in nitrates. Fermenting corn as...
http://deltafarmpress.com/corn/drought-stressed-corn-concerns
*  Crab And Sweet Corn Soup Recipe by Easy.Meals | iFood.tv
Crab And Sweet Corn Soup Recipe by Easy.Meals. iFood.tv. Skip to main content. Topics Upload Recipes Posts Fawesome.tv Answers African American Appetizer Asian Bar Beverage Bread Breakfast Brownie Burger Cake Canadian Candy Caribbean Casserole Chinese Chips Cocktail Continental Cookie Cuban Cupcake Curry Custard Dessert Dip Dressing European Filipino French Frosting Fusion German Gravy Greek Hamburger Hash Brown Indian Interest Italian Japanese Jewish Ketchup Lasagna Latino Loaf Sitemap Main Dish Marinade Mayonnaise Meatball Mediterranean Mexican Mousse Muffin Oceanian Side Dish Snack South American Spanish Thai Wine And Drink About. Search form Search. Crab and Sweet Corn Soup By: Easy.Meals. Sweet Corn Soup With Crab By: Chef.Billy.Parisi. Crab And Corn Soup By: Microwave.Lady. Crab And Corn Soup By: admin. Crab And Corn Soup By: Gadget.Cook. Crab And Sweet Corn Soup By: admin. You are here Home » Soup » Seafood Soup » Crab Soup » Crab Corn Soup » Crab and Sweet Corn Soup. Crab and Sweet Corn Soup. Easy.Mea...
http://ifood.tv/soup/233075-crab-and-sweet-corn-soup
*  [Q] Olympus KERNEL development progress | Motorola Atrix 4G | XDA Forums
Olympus KERNEL development progress. Motorola Atrix 4G. XDA Forums. XDA TV. Apps. Google+. xda-developers. Motorola Atrix 4G. Atrix 4G Q A, Help Troubleshooting. Olympus KERNEL development progress by nejati. FORUMS. Atrix 4G Q A, Help Troubleshooting. Atrix 4G General. Atrix 4G Android Development. Atrix 4G Themes and Apps. Can/Will You Update to Android Marshmallow ASAP. October 2, 2015. What Google Missed on the Nexus 5x and Nexus 6P XDA TV October 2, 2015. October 2, 2015. More XDA News. Olympus KERNEL development progress 10 posts Thanks Meter : 0. View Profile. View Forum Posts. Thread Closed. Subscribe to Thread. Email Thread. how could I find Olympus KERNEL development progress in XDA or anywhere else. latest thread update shows September 2013, did this project stopped. does atrix android development still alive. View Profile. View Forum Posts. 4,184 posts Join Date: Joined: May 2008 My Devices: Google Nexus 10, Google Nexus 5, Nexus 6, Nexus Player. Hi, Please use the XDA search or even Google before...
http://forum.xda-developers.com/showthread.php?p=52039421
*  best frozen corn kernels recipes | BigOven
best frozen corn kernels recipes. BigOven. Survey by Qualaroo. Join Free Sign In Add Recipe. Get Ideas. My Recipes. Grocery List. Menu Planner. Use Up Leftovers. Add Recipe. JOIN FREE. SIGN IN. Recipes. best frozen corn kernels recipes BigOven found 1,047 recipes, shown in order of quality. sort by rating searching anywhere in recipe. Narrow search to just "frozen corn kernels" in the title. Refine or sort. Main Dish 349. Soups, Stews and Chili 260. Side Dish 146. Salad 74. Bread 32. Appetizers 27. Breakfast 20. Desserts 13. Refine your search then. -- any -- Appetizers Bread Breakfast Desserts Drinks Main Dish Salad Side Dish Soups, Stews and Chili Marinades and Sauces Other. sort by Title DateAsc DateDesc Rating Quality. Title. INCLUDE Ingredients. EXCLUDE Ingredients. Dietary filters BigOven Pro required try it free Vegetarian Vegan Contains cheese Gluten free Nut free Dairy free No shellfish No tree nuts No white meat No red meat Contains Pasta Notice a categorization error. Let us know by clicking on the...
http://bigoven.com/recipes/frozen corn kernels/best
*  Corn stover
... Image:Illustration Zea mays0.jpg|thumb|'Zea mays' ssp. 'mays' L. 'Corn stover' consists of the leaves and stalks of maize 'Zea mays' ssp. 'mays' L. plants left in a field after harvest and consists of the residue : stalk ; the leaf, husk, and cob remaining in the field following the harvest of cereal grain. As well as the non-grain part of harvested corn, the stover can also contain other weeds and grasses. Use Composition and properties See also References. Corn stover, together with other lignocellulosic biomass, potentially amounts to 1.3 billion tons of raw materials over the next 50 years that could be used for fuel production. Corn stover is not harvested in all areas where corn is produced. Corn stover can be beneficial to some cattle producers because the “corn stover can provide a low cost feed source for mid-gestation beef cows.” In addition to the stalks, leaves, husks, and cobs remaining in the field, kernels of grain may also be left over from harvest. These left over kernels, along with the...
https://en.wikipedia.org/wiki/Corn_stover
*  Patent US6040497 - Glyphosate resistant maize lines - Google Patents
A fertile transgenic maize plant comprising a chromosomally integrated expression cassette comprising i a modified maize EPSPS gene encoding an EPSPS protein having isoleucine at position 102 and serine at position 106 and ii a promoter active in maize operably linked to said EPSPS gene, wherein the yield of said fertile transgenic maize plant is not affected by a glyphosate application rate that affects the yield of a maize plant lacking said modified maize gene, wherein said fertile transgenic maize plant comprises a transformation event selected from the group consisting of GA21, seed comprising said GA21 transformation event having been deposited as ATCC Accession Number 209033, FI117, seed comprising said FI117 transformation event having been deposited as ATCC Accession Number 209031, GG25, seed comprising said GG25 transformation event having been deposited as ATCC Accession Number 209032, and GJ11, seed comprising said GJ11 transformation event having been deposited as ATCC Accession Number 209030....
http://google.com/patents/US6040497?ie=ISO-8859-1
*  ARS Project: GENETIC ANALYSIS OF SELECTION RESPONSE IN MAIZE POPULATIONS (413379) ARS : Research
ARS Project: GENETIC ANALYSIS OF SELECTION RESPONSE IN MAIZE POPULATIONS 413379 ARS : Research. ARS Office of International Research Programs. Research Project: GENETIC ANALYSIS OF SELECTION RESPONSE IN MAIZE POPULATIONS. For the next five-year research cycle we will: Objective 1: Identify key morphological phenotypes and the underlying genes and/or genetic systems that have contributed to improvement in grain yield and other important agronomic phenotypes in maize. Approach: Objective 1: We will map genomic regions and attempt to identify candidate genes for morphological phenotypes that may have changed in response to selection for agronomic performance in the Iowa Stiff Stalk Synthetic population. We will determine the magnitude of selection response for these traits in Iowa Stiff Stalk Synthetic population and determine if any of these are correlated to agronomic traits in the base population. We will then use advanced cycles of selection and the base population to generate a genetic mapping experiment to...
http://ars.usda.gov/research/projects/projects.htm?ACCN_NO=413379
*  Corn wet milling
... Tate Lyle. Contact us. Partner sites. RSS. Cookie information. Home. About us Ingredients and services Responsibility Investor relations Media centre Careers You are here:. Home. About us. Our industry. Corn wet milling. Print. Email. C. Large text size. Medium text size. Small text size. Our Values. Our strategy. Our brand promise. Our structure. Our markets. Where we operate. Key people. Board of directors. Executive management. Key financials. Our industry. Corn wet milling. Sucralose. Useful links. History. Henry Tate. Abram Lyle. Augustus Eugene Staley. Georg Carl Hahn. The Callebaut Brothers. Case studies. Corn wet milling Corn wet milling is the process by which we refine corn maize to manufacture products that are used by millions of people around the world each day. During this process, which we have outlined below, none of the corn is wasted – every part of every kernel is used in some way to produce the quality ingredients that our customers want. Tate Lyle uses two types of corn: dent and wax...
http://tateandlyle.com/aboutus/ourindustry/pages/cornwetmilling.aspx
*  NMSU: Specialty Corns
Publications Videos. The most common types of corn include flint, flour, dent, pop, sweet, and waxy. Endosperm distribution in five types of corn kernels. A seventh type of corn called pod or tunicate may also be characterized by flint, dent, flour, sweet, pop, or waxy endosperms. Dent corns with flinty sides and soft cores of starch that cause the end of the kernels to collapse or dent during drying fall between the flint and flour types. Although most dent corns produced in the United States have yellow endosperms, white dents are very popular in human food products because of the whiter starch. White dent corns often receive a premium price from the dry-milling industry since yields are somewhat less than those of the yellow dent corn hybrids. Supersweet varieties with this gene exhibit sucrose levels two to three times greater than standard sweet corn at harvest, and two days after harvest sucrose levels will still be relatively high. Although sh-2 varieties contain more sucrose at and after harvest than ...
http://aces.nmsu.edu/pubs/_h/H232/welcome.html
*  .. Planting Sweet Corn
Planting Sweet Corn. 2/20/2010 · by. · in Corn, Cucumbers, Garden Review, VEGETABLES How to sucessfully plant and grow sweet corn. Depending on the cultivar, sweet corn needs 60-100 warm days to grow and requires 8 to 10 hours of full sun, good drainage and lots of room. Planting corn Once the soil warms up, plant seeds 1-2 inches deep, in groups or hills with 3-4 seeds in them. Space the hills about 1 1/2 ft apart. Seeds may also be sown in single rows of 9 inches apart, spacing 2 to 3 feet between rows, with a minimum of 4 rows to assure cross pollination. Corn is a heavy feeder and needs ample nutrients to produce, therefore, before planting, apply 10-10-10 fertilizer at the rate of 1 1/2 pounds per 100 square feet to the soil. When the corn gets about 1 1/2 feet tall, again side-dress with 10-10-10. When the plants start tasseling and silking, make sure it gets at least one inch of water per week. Do not allow wilting at this time as it will affect pollination and kernel development. Harvesting corn Harve...
http://hortchat.com/info/sweet-corn
*  Corn Belt prays for rain to rescue crops | Cattle Network
Corn Belt prays for rain to rescue crops. Cattle Network. Industry Markets USDA Market Reports Ag Policy Drovers Radio Advice + Tips. My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage Quotes + Weather. Drovers/CattleNetwork Cow/Calf Producer Drovers Cow/Calf Buyers Guide. Tractors 150 hp Pasture Management Small Farm, Ranch Vehicles and ATVs Calf Health Manure Management Silage Equipment Webinars Facebook Link. Twitter Link. Instagram Link. RSS Index Link. Menu. Drovers Cattle Network. Facebook Link. Twitter Link. Instagram Link. RSS Index Link. Connect with us on Facebook, Twitter and Instagram. Search form Search. News Quality Silage My Beef Checkoff Drovers Cow/Calf Quotes Subscribe. Industry Corn Belt prays for rain to rescue crops. By Angela Bowman July 12, 2012. The Corn Belt is sizzling under Mother Nature’s current weather pattern of dry, oppressive heat. Some experts now anticipate that the 2012 Midwest drought c...
http://cattlenetwork.com/cattle-news/Corn-Belt-prays-for-rain-to-rescue-crops-162240875.html?email=yes&cmntid=96277596
*  ARS | Publication request: Influence of Corn (Zea mays L.) Cultivar Development on Residue Productio
Publication request: Influence of Corn Zea mays L. Cultivar Development on Residue Production ARS : Research. International Programs. You are here: MID SOUTH AREA Home / SOIL DYNAMICS RESEARCH / Research / Publication #253995. Related Topics Programs and Projects. ARS Office of International Research Programs. Title: Influence of Corn Zea mays L. Cultivar Development on Residue Production Authors. Submitted to: Journal of Plant Nutrition Publication Type: Peer Reviewed Journal Publication Acceptance Date: September 13, 2011 Publication Date: March 19, 2012 Repository URL: http://handle.nal.usda.gov/10113/55180 Citation: Dos Santos, N., Prior, S.A., Gabardo, J., Valaski, J., Motta, A., Ferreira Neto, A. Influence of corn Zea mays L. cultivar development on residue production. Interpretive Summary: Corn genetic selection can influence biomass production and tissue quality. Varieties representing different degrees of breeding development used in Brazil were evaluated i.e., landrace, commercial variety, double cr...
http://ars.usda.gov/research/publications/publications.htm?SEQ_NO_115=253995&pf=1
*  Quickie se Sweet Corn
... Tomatoes Heirloom Vegetables Flavor Favorites Organic Seeds Other Vegetable Seeds. Growing Supplies Gardening Supplies Hedges & Shrubs Kitchen & Harvesting Organic Seeds. Gardening Supplies ». Vegetable Seeds ». Quickie se Hybrid Sweet Corn. Seed Counts : A packet of 250 sweet corn seeds sows a 50-ft. packet of sweetcorn seeds sows a 200-ft. 2009-10-09 good Reviewed By: Christian Hillsboro, wi Great corn, I planted it to close together but it came up and kept on growing. 2008-06-01 19-19-19 Reviewed By: timm1 Ashland Co., Ohio I read some reveiws as to short stalks and poor kernal placement.I grow sweet corn of all 3 types su,se&sh2 first of all if you want your corn cob to fill out make sure you block your corn rows say you only have 500 seeds do 5 rows of 100 seeds to polinate well.remember the tasles fall on the silk to form those kernals if it only carrys thru 2 rows its just not going to do good.befor even getting to that point corn likes nitrogen and lots of it.I start with 12-12-12 at plan...
http://gurneys.com/product/quickie_se_sweet_corn_/corn-seed
*  More Iowa farmers relying on corn stover | Newton Daily News
More Iowa farmers relying on corn stover. Newton Daily News. Subscribe to Newton Daily News. News. News Home. Local. Sports Home. Local. Opinion Home. Video. News Video. Live Video. Subscribe to the Newton Daily News. Business Showcase. Subscriber Services. Today's Ads. News. Sports. Video. More Iowa farmers relying on corn stover. By DAVE DEWITTE The Gazette CEDAR RAPIDS AP — When Iowa farmers were done harvesting this year’s drought-stunted 2012 corn crop this fall, many of them didn’t stop there. They returned to the fields to chop and rake the dried cornstalks into round bales that, at first glance, don’t look much different from hay bales. The material is known as corn stover. Experts say farmers began harvesting more of it in the last few years of rising hay and grain prices, and harvested a lot more of it this year as the 2012 drought drove hay prices to record levels. Corn stover is different from silage, a livestock feed typically made by chopping up green corn plants and ...
http://newtondailynews.com/2012/12/03/more-iowa-farmers-relying-on-corn-stover/actul8h/
*  Grilled Chili Lime Sweet Corn Recipe - Food.com
... Toggle navigation. cancel. TOP. Toggle search field. Log In. Sign Up. Featured 30 Chicken Dinner Winners Home. Recipes. Photo Galleries. Videos. More Food.com Newsletters. Blog. Recipe Box. Grocery List. Inbox. Add a Recipe. Log Out. Log In. Sign Up. Filters Close Search What's in Your Fridge. Includes. Stumped for dinner. Get our life-saving Dinner Daily newsletter. Sign up. Recipes. Corn Grilled Chili Lime Sweet Corn By Ackman. Upload Your Recipe Photo. Recipe Box. Grocery List. Print. Share. Total Time 50 mins. Prep 20 mins. Cook 30 mins. Make and share this Grilled Chili Lime Sweet Corn recipe from Food.com. Skip to Next Recipe. Ingredients Nutrition Servings 6-8. Units US. 6 -8 ears sweet corn 1. lime. 1 tablespoon kosher salt. 1 tablespoon chili powder I use Chili Pleasoning...see link below. 1 tablespoon sugar. Check Out Our Top Corn Recipe. Directions Husk the corn remove all the silks. Using a sharp knife, cut the corn off the ears place in an aluminum pan large enough to hold all the corn. I us...
http://food.com/recipe/grilled-chili-lime-sweet-corn-462543
*  Stover Seed Company: Argent White Hybride Sweet Corn Seeds
stover seed company argent white hybride sweet corn seeds previous page argent white hybride sweet corn outstanding flavor disease resistant days to harvest sweet corn is among the most popular home grown vegetables nothing equals the taste of freshly picked and cooked sweet corn the three essential ingredients for success are adequate space water and heat argent is a white corn with excellent eating quality and improved disease resistance ears are to inches with rows of kernels seed depth in row spacing in seed spacing in plant spacing in days to sprout days to harvest pollination is essential for success so corn needs to be planted in a block of three rows of plants rather than one row make successive plantings every two weeks to prolong harvest thin when plants are inches high water frequently by soaking the soil at least inch per week apply a balanced fertilizer during the growing season in a furrow inches away from plants mulching helps to keep soil moist harvest when ears are completely filled out and a...
http://stoverseed.com/P_vegetables_11.html
*  ARS | Publication request: Molecular characterization of diverse CIMMYT maize inbred lines from east
Publication request: Molecular characterization of diverse CIMMYT maize inbred lines from eastern and southern Africa using single nucleotide polymorphic markers ARS : Research. ARS Office of International Research Programs. Title: Molecular characterization of diverse CIMMYT maize inbred lines from eastern and southern Africa using single nucleotide polymorphic markers Authors. Molecular characterization of diverse CIMMYT maize inbred lines from eastern and southern Africa using single nucleotide polymorphic markers. Molecular markers can be used to construct the patterns of relationships among lines in a breeding program, and this has been done in maize for most of the world’s important breeding programs. In Africa, however, this has only rarely been done, and this article presents the results of a molecular marker diversity analysis of 450 maize lines developed and/or widely used by CIMMYT breeding programs in Kenya and Zimbabwe. The molecular markers used are new SNP markers, and the performance of each m...
http://ars.usda.gov/research/publications/Publications.htm?seq_no_115=275399
*  Sweet Corn, Small Areas
... For instance, four rows that are 10 feet long will require about 100 square feet and should produce four to five dozen ears. Normal good garden site selection and soil preparation are important: choose full sun location, have your soil tested, and add organic matter compost is the best. However, if you garden in a very sandy soil, it is best to add the potassium in stages with the nitrogen, too. one third at planting, one third when the corn is knee high, one third when corn starts to tassel. However, an addition of 2 to 4 inches of compost tilled into the soil before planting should help to prevent that problem. Sweet corn does not germinate well if soil temperatures are below 55 degrees 60 for the supersweet varieties and grows best at 75 to 85 degrees. Seed can be spaced as closely as 6 to 8 inches apart in rows 28 to 32 inches apart. Therefore, corn planted in long single rows does not usually receive the proper pollination and produces ears which are not "filled out." Plant your corn in shorter rows...
http://texasgardener.com/pastissues/marapr99/corn.html
*  Sweet Corn Casserole Recipe | Meals.com
Sweet Corn Casserole Recipe. Meals.com. Meals. Recipes. Sweet Corn Casserole. In this recipe:. Low sodium Vegetarian This sweet corn-studded casserole is a great side to serve with practically any main dish. Goes well with Mexican, South American and American cuisine. Your Email:. Close Success. Close. Ingredients 1/2 cup masa harina flour Mexican corn masa mix. 1/4 cup 1/2 stick butter or margarine 2 tablespoons vegetable shortening 2 cups frozen whole-kernel corn, partially thawed 3 tablespoons cold water 1/4 cup granulated sugar 3 tablespoons yellow corn meal 2 tablespoons NESTLÉ® CARNATION® Evaporated Milk 1/4 teaspoon baking powder 1/4 teaspoon salt 1 teaspoon chili powder optional. Directions, Reviews, Nutrition Directions PREHEAT oven to 350° F. Add corn and water; process until corn is coarsely chopped. Combine sugar, corn meal, evaporated milk, baking powder and salt in medium bowl. Sprinkle with chili powder. Your Email:. Close Success. Close. With an added twist I think that with the chili powder s...
http://meals.com/recipe/sweet-corn-casserole-29772
*  Seeking fix for corn fungus - tribunedigital-chicagotribune
... Sections. Home. News. Business. Sports. A&E. Lifestyles. Opinion. Real Estate. Cars. Jobs. Home. News. Business. Sports. A&E. Lifestyles. Opinion. Real Estate. Cars. Jobs. Seeking fix for corn fungus. October 01, 2012. By Tim Johnson. Special to Tribune Newspapers. Corn smut is a fungus. HANDOUT. I have tried growing sweet corn for the first time this year. I have noticed that some of the ears have misshapen kernels with what appears to be a black growth. What is this and what should I do. -- Lisa Jenkins, Barrington It sounds like you are seeing corn smut, which is a fairly common disease on sweet corn. It is caused by a fungus that can infect various parts of the corn plant, including stalks, ears, leaves and tassels. When the fungus infects the developing kernels in an ear of corn, it can lead to the formation of galls that can grow quite large. These galls, sometimes 4 to 5 inches wide, typically have a silvery gray outer coating and look like super-sized corn kernels. Inside is a mass of black fungu...
http://articles.chicagotribune.com/2012-10-01/classified/ct-sun-garden-corn-smut-20121001_1_corn-smut-sweet-corn-corn-kernels
*  Estimation of in-canopy ammonia sources and sinks in a fertilized Zea Mays field - NERC Open Resea
... rch Archive. nerc.ac.uk. Help. Contact us. Home. About. Browse. Search. Statistics. NERC Staff Login. Estimation of in-canopy ammonia sources and sinks in a fertilized Zea Mays field. Tools Tools Tools. RDF+XML BibTeX RDF+N-Triples JSON RefWorks Dublin Core Simple Metadata Refer METS Simple Metadata iShare HTML Citation ASCII Citation OpenURL ContextObject EndNote Dublin Core iShare OpenURL ContextObject in Span MODS MPEG-21 DIDL EP3 XML Reference Manager RDF+N3 Multiline CSV. Bash, Jesse O. ; Walker, John T. ; Katul, Gabriel G. ; Jones, Matthew R. ; Nemitz, Eiko ; Robarge, Wayne. 2010 Estimation of in-canopy ammonia sources and sinks in a fertilized Zea Mays field. Environmental Science Technology, 44 5. 1683-1689. 10.1021/es9037269. Full text not available from this repository. Official URL: http://pubs.acs.org/doi/abs/10.1021/es9037269 Abstract/Summary An analytical model was developed to describe in-canopy vertical distribution of ammonia NH3 sources and sinks and vertical fluxes in a fertilized agric...
http://nora.nerc.ac.uk/9341/
*  Freezer Sweet Corn Recipe | Taste of Home
freezer sweet corn recipe taste of home back to freezer sweet corn print options recipe photo nutritional facts card sizes full page x x print freezer sweet corn recipe whenever i serve this summertime go to people can t believe that it s frozen and not fresh it stays crisp tender and now i can have fresh corn any time of the year judy oudekerk st michael minnesota total time prep min cook min yield servings freezer sweet corn recipe whenever i serve this summertime go to people can t believe that it s frozen and not fresh it stays crisp tender and now i can have fresh corn any time of the year judy oudekerk st michael minnesota total time prep min cook min yield servings ingredients quarts fresh corn cut from about ears quart hot water cup sugar cup butter cubed teaspoons salt directions in a stockpot combine all ingredients bring to a boil reduce heat simmer uncovered minutes stirring occasionally transfer to large shallow containers cool stirring occasionally freeze in resealable plastic freezer bags or fr...
http://tasteofhome.com/recipes/freezer-sweet-corn/print
*  Molecular Expressions: Science, Optics & You - Olympus MIC-D: Brightfield Gallery - Corn Root Tissue
... Visit the Molecular Expressions Website. Image Use. Brightfield Digital Image Gallery Corn Root Tissue. Corn is the common name for the cereal grass widely grown as food for humans and animals. Native to the Americas, corn Zea mays, the domesticated variety of the Zea grass family, originally was cultivated by Native Americans 8,000 to 10,000 years ago and is now used for human food and animal feed. View a high magnification image of corn root tissue. Corn plants have an erect, solid stem, rather than the hollow stem characteristic of most other grasses. Rather, they are characterized by scattered vascular bundles composed of xylem and phloem tissue, with each bundle surrounded by a bundle sheath. The corn plants vary widely in height, from 2 feet 61 centimeters to 18 feet 5.5 meters, depending on the variety. The plants have long narrow leaves that grow alternately along the length of the stalk. An early maturing hybrid may develop fewer leaves or progress to different stages at a faster rate than wild ...
http://micro.magnet.fsu.edu/optics/olympusmicd/galleries/brightfield/cornstemlow.html
*  IJMS | Free Full-Text | Maize ZmRACK1 Is Involved in the Plant Response to Fungal Phytopathogens |
Induction of ZmRACK1 expression was observed in maize leaves after treatment with ABA and MeJa. found that RACK1 expression improved in wild-type rice suspension cells after 1 h treatment with ABA and MeJa, but the expression level was not increased more than two times in the following 9 h of continuous treatment. Therefore, the disease resistance of transgenic maize plants overexpressing ZmRACK1 was examined. Quantitative real-time RT-PCR analysis of the ZmRACK1 gene in the leaves of transformed maize. Quantitative real-time RT-PCR analysis of the ZmRACK1 gene in the leaves of transformed maize. A ZmRACK1 -overexpressing maize leaves L36, L38 and L39 and non-transgenic maize leaves WT after infection with E. A ZmRACK1 -overexpressing maize leaves L36, L38 and L39 and non-transgenic maize leaves WT after infection with E. The results showed that ROS were produced from both overexpression lines and the wild-type, but a darker color was observed in the corresponding position of the transgenic lines Figure 5 A. ...
http://mdpi.com/1422-0067/15/6/9343/htm
*  ARS | Publication request: Adaptability and performance of short-season maize hybrids in the souther
ARS. Publication request: Adaptability and performance of short-season maize hybrids in the southern high plains ARS : Research. ARS Home. About ARS. National Programs. International Programs. Find a location. Site Map. You are here: SOUTHERN PLAINS AREA Home / PLANT STRESS AND GERMPLASM DEVELOPMENT RESEARCH / Research / Publication #281322. Related Topics Programs and Projects. ARS National Programs. ARS Office of International Research Programs. ARS Office of International Research Programs Regional Contacts. Title: Adaptability and performance of short-season maize hybrids in the southern high plains Authors. Technical Abstract: Drought incidences change with year and location, and are prevalent in the Southern High Plains where annual rainfall is low and highly variable and most maize and other crops are irrigated. The low rainfall and groundwater overuse are leading to shortages of water for crop irrigation in this region. Full-season maize hybrids require greater amounts of water throughout the growing ...
http://ars.usda.gov/research/publications/publications.htm?seq_no_115=281322
*  ARS | Publication request: Reinventing MaizeGDB ARS : Research
ARS. Publication request: Reinventing MaizeGDB ARS : Research. ARS Home. About ARS. Search for This. Research Projects. International Programs. Find an office at headquarters. Careers at ARS Info. Site Map. Related Topics Programs and Projects. ARS National Programs. Search for a research project. ARS Office of International Research Programs. ARS Office of International Research Programs Regional Contacts. ARS International Research Partnerships. THE MAIZE GENETICS AND GENOMICS DATABASE. Title: Reinventing MaizeGDB Authors. Andorf, Carson. Submitted to: Maize Genetics Conference Abstracts Publication Type: Abstract Only Publication Acceptance Date: March 1, 2011 Publication Date: March 5, 2011 Citation: Andorf, C.M., Cannon, E.K., Braun, B.L., Birkett, S., Harper, E.C., Schaeffer, M.L., Gardiner, J., Jayasingam, D., Campbell, D.A., Sen, T.Z., Lawrence, C.J. Reinventing MaizeGDB. 53rd Annual Maize Genetics Conference Program and Abstracts. Technical Abstract: The Maize Database MaizeDB to the Maize Genetics a...
http://ars.usda.gov/research/publications/publications.htm?SEQ_NO_115=264708
*  Work toward labels for genetically engineered food — Opinion — Bangor Daily News — BDN Maine
Work toward labels for genetically engineered food Opinion Bangor Daily News BDN Maine. News and weather for:. Opinion. News. Business. Sports. Outdoors. Food. Events. Opinion. Blogs. Bangor. Portland. The Maine Board of Pesticides Control recently approved for growing in Maine Bt sweet corn, a genetically engineered, or GE, food product developed by Syngenta. This summer when locally grown sweet corn hits the market consumers won t be able to tell if the corn they re purchasing is a genetically engineered or traditional variety. Bt sweet corn is a genetically modified organism, or GMO, and is fundamentally different from the sweet corn that traditionally has been grown in Maine. Bt sweet corn seed is regulated as a pesticide. In fact, at its recent meeting one member of the pesticides board said he favored approval of Bt sweet corn because it would reduce the need for applying other pesticides aimed at controlling the borer. Several board members noting virtually all of the sweet corn grown in Maine is consu...
http://bangordailynews.com/2009/04/05/opinion/work-toward-labels-for-genetically-engineered-food/
*  Tex-Mex Grilled Sweet Corn Tomato Salad | TasteSpotting
tex mex grilled sweet corn tomato salad tastespotting tastespotting features the delicious life facebook twitter tastespotting want to submit something delicious login or register first browse by date category popularity random tex mex grilled sweet corn tomato salad blommi com tex mex grilled sweet corn tomato salad submitted by blommi save as favorite tags corn salad tex mex salad corn tomato cinco de mayo tomato salad vegan vegetarian gluten free next prev conversation things are little quiet around here why don t you get a little conversation going you conversation starter you register or log in first please more good taste site information home about contact faqs submission guidelines goodies terms of use...
http://tastespotting.com/detail/225318/Tex-Mex-Grilled-Sweet-Corn-Tomato-Salad
*  Did you know that corn kernels turn to liquid before becoming popcorn?
Did you know that corn kernels turn to liquid before becoming popcorn....
http://sploid.gizmodo.com/everything-you-ever-wanted-to-know-about-pop-corn-in-90-1536477014
*  Get The Most Of Your Corn Crop | BEEF Daily
Get The Most Of Your Corn Crop. BEEF Daily. Skip to Navigation Skip to Content BEEF Magazine. Beef Quality. Cattle Prices Grain Prices Marketing. Grazing Systems Pasture Health. Home > Blogs > BEEF Daily > Get The Most Of Your Corn Crop. Get The Most Of Your Corn Crop Aug 6, 2012 by Amanda Radke in BEEF Daily. RSS EMAIL. 0 How will you manage your corn crop this year. I think one of the key things that any farmer needs to consider before making a decision on his crop -- whether to save it for harvest or to use it for livestock feed -- is to evaluate the yield potential. Because of these high prices, using corn for livestock feed could be a mistake. Assess the crop for yield potential to make a more informed decision, and if you do sell the silage, make sure you are being appropriately compensated for your corn, suggests Fanning. Fannning advises producers to check the nitrate levels and herbicide restrictions on the corn crop before cutting it for silage. Finally, Fanning says that with the high c...
http://beefmagazine.com/blog/get-most-your-corn-crop
*  Paramutation
thumb|200px|Paramutation was first observed by the effect it had on the color of corn kernels in maize plants. In epigenetic s, a 'paramutation' is an interaction between two allele s at a single locus, whereby one allele induces a heritable change in the other allele. The change may be in the pattern of DNA methylation, for example. The allele inducing the change is said to be paramutagenic, whilst the allele that has been epigenetically altered is termed paramutant or paramutated. A paramutant allele may have altered levels of gene expression, which may continue in offspring which inherit that allele, even though the paramutagenic allele may no longer be present. At 'r1' in maize, for example, the weaker expression state adopted by a paramutant allele can range from completely colorless to nearly fully colored kernels. History Mechanism Occurrence Notes References. Brink noticed that specific weakly expressed alleles of the 'red1' ' r1 ' locus in maize, which encodes a transcription factor that confers red ...
https://en.wikipedia.org/wiki/Paramutation
*  Should I reduce residue to reduce corn disease? | Cattle Network
Should I reduce residue to reduce corn disease. Industry Markets USDA Market Reports Ag Policy Drovers Radio. My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage. Drovers/CattleNetwork Cow/Calf Producer. Drovers Cow/Calf Buyers Guide. Twitter Link. Instagram Link. RSS Index Link. Drovers Cattle Network. Facebook Link. Twitter Link. Instagram Link. RSS Index Link. Connect with us on Facebook, Twitter and Instagram. News Quality Silage My Beef Checkoff Drovers Cow/Calf Quotes Subscribe. Should I reduce residue to reduce corn disease. The presence of some foliar corn diseases is partially explained by the presence of "residue." However, that increase is not completely explained by the presence of residue and for some diseases the presence of residue does not even factor into the appearance of disease. Some foliar diseases overwinter somewhere other than residue. Other foliar corn diseases overwinter in residue "plus" another l...
http://cattlenetwork.com/cattle-news/Should-I-reduce-residue-to-reduce-corn-disease--139460593.html?view=all
*  ETH ETH E-Collection: Combined effect of male sterility and xenia on grain yield and yield com
... ponents in maize Zea mays L. - ETH E-Collection. Skip to main content Skip to navigation Skip to toolbar ETH E-Collection ETH Institutional Repository Swiss Federal Institute of Technology Zurich. Navigation Home. Search. Browse. Publish. Contact. About E-Collection. Toolbar. English. Deutsch You are not logged in. Login. Combined effect of male sterility and xenia on grain yield and yield components in maize Zea mays L. Metadata Label Value Author s : Weingartner, Urs. Publisher: Unknown. Citation: Weingartner, Urs. Combined effect of male sterility and xenia on grain yield and yield components in maize Zea mays L. 2002. http://dx.doi.org/10.3929/ethz-a-004433666. Document Type: Doctoral and Habilitation Theses. Documents: Abstract. 75.33KB,. Fulltext. 601.47KB. Import to Mendeley. Detailed Information Metadata. Documents. Links. Statistics. Metadata Description Title Combined effect of male sterility and xenia on grain yield and yield components in maize Zea mays L. Author s Weingartner, Urs. Publicatio...
http://e-collection.library.ethz.ch/view/eth:25870?q=(keywords_en:PLANT BREEDING)
*  Flint corn
... zea mays indurata also known as indian corn or sometimes calico corn is a variant of maize var linnaeus the same species as common corn indian corn because each kernel has a hard outer layer to protect the soft endosperm it is likened to being hard as flint hence the name history distinctive traits coloration uses references history with less soft starch than dent corn zea mays indentata flint corn does not have the dents in each kernel from which dent corn gets its name blue corn unique to american southwest this is one of the three types of corn cultivated by native americans both in new england and across the northern tier including by tribes such as the pawnee on the great plains archeologist s have found evidence of such corn cultivation by the pawnee and others before bc...
https://en.wikipedia.org/wiki/Flint_corn
*  BBCH-scale (maize)
BBCH-scale maize. BBCH-scale maize. In biology, the 'BBCH-scale for maize' describes the phenological development of maize using the BBCH-scale. The phenological growth stages and BBCH-identification keys of maize are:. Growth stage Code Description. Dry seed caryopsis. Beginning of seed imbibition. Seed imbibition complete. Radicle emerged from caryopsis. Coleptile emerged from caryopsis. 1: Leaf development 1, 2. First leaf through coleoptile. First leaf unfolded. 2 leaves unfolded. 3 leaves unfolded. Stages continuous till. 9 or more leaves unfolded. 3: Stem elongation. Beginning of stem elongation. 2 nodes detectable. 3 nodes detectable. Stages continuous till. 9 or more nodes detectable 3. Beginning of tassel emergence: tassel detectable at top of stem. Tip of tassel visible. Middle of tassel emergence: middle of tassel begins to separate. End of tassel emergence: tassel fully emerged and separated. Male: stamens in middle of tassel visible Female: tip of ear emerging from leaf sheath. Male: beginning ...
https://en.wikipedia.org/wiki/BBCH-scale_(maize)
*  Abstract | Digital LibraryAbstract
American Society of Agronomy Crop Science Society of America Soil Science Society of America. Home » Publications » Soil Science Society of America Journal Abstract View My Binders. Please log in to your account to view your binders. View »Abstract »Full Text PDF »Table of Contents. doi: 10.2136/sssaj1956.03615995002000020019x Immobilization and Mineralization Rates of Nitrogen during Decomposition of Plant Residues in Soil 1 B. Soils were treated with either wheat straw or corn leaves, and inorganic nitrogen ammonia or nitrate. Ammonia and nitrate nitrogen were determined. Recovery data indicate that rapid immobilization took place when wheat straw was added in combination with either ammonia or nitrate nitrogen. Immobilization of added ammonia occurred when corn leaves were added with ammonia nitrogen. Reduction of nitrate was negligible in treatments where corn leaves plus nitrate nitrogen were added. Mineralization and immobilization data indicate that a substantial amount of nitrogen is turned over in th...
https://dl.sciencesocieties.org/publications/sssaj/abstracts/20/2/SS0200020213
*  Corncob
... image pannocchia sgranata jpg thumb right corncobs with most of the kernels removed file corn jpg thumb right closeup of an ear of corn with the kernels still attached to the cob a corncob also spelled corn cob is the central core of an ear of maize zea mays ssp mays it is the part of the ear on which the kernels grow the ear is also considered a cob or pole but it is not fully a pole until the ear is shucked or removed from the plant material around the ear young ears also called baby corn can be consumed raw but as the plant matures the cob becomes tougher until only the kernels are edible when harvesting corn the corncob may be collected as part of the ear necessary for corn on the cob or instead may be left as part of the corn stover in the field the innermost part of the cob is white and has a consistency similar to foam plastic uses corncobs find use in the following applications industrial source of the chemical furfural fiber in fodder for ruminant livestock despite low nutritional value water in...
https://en.wikipedia.org/wiki/Corncob
*  USDA: Corn Crop Larger Than Expected | InvestorPlaceInvestorPlace
USDA: Corn Crop Larger Than Expected. InvestorPlaceInvestorPlace. USDA: Corn Crop Larger Than Expected by Christopher Freeburn. September 12, 2012 12:31 pm The lingering drought in the Midwest did not hurt this year s corn crop as much as feared. A report issued by the U.S. Department of Agriculture USDA on Wednesday forecast this year s corn harvest at 10.727 billion bushels. That was down from an earlier forecast of 10.779 billion bushels, but well above the 10.420 billion bushels that analysts had predicted, Bloomberg noted. The better-than-expected harvest estimate sent corn prices tumbling to their lowest levels in seven weeks. Corn prices had jumped 54% since June as the drought continued to roast corn belt states. According to the government, this year s harvest will still be 13% below 2011 s 12.358 billion-bushel yield and the lowest harvest in six years. With less corn available, feed prices for livestock producers like Tyson Foods NYSE:TSN and Smithfield Foods NYSE:SFD have risen. Low corn supplies ...
http://investorplace.com/2012/09/usda-corn-crop-larger-than-expected/print
*  Genetically modified maize
... 'Genetically modified maize' corn is a genetically modified crop. GM maize has also caused controversy with respect to possible health effects, impact on other insects and impact on other plants via gene flow. Products in development Refuges Resistance Regulation Controversy Effects on nontarget insects. Food. Herbicide resistant maize. In 1996, the first GM maize producing a Bt Cry protein was approved, which killed the European corn borer and related species; subsequent Bt genes were introduced that killed corn rootworm larvae. 6 Refuges. EPA regulations also require seed companies to train farmers how to maintain refuges, to collect data on the refuges and to report that data to the EPA. Seed bags containing both Bt and refuge seed have been approved by the EPA in the United States. Wesseler 2011 : Coexistence of genetically modified GM and non-modified non GM crops: Are the two main property rights regimes equivalent with respect to the coexistence value. Concerns focus on the interaction between GM ...
https://en.wikipedia.org/wiki/Genetically_modified_maize
*  The identification of maize lines with contrasting responses to applied nitrogen. - Research Portal
... Lancaster University. Home. Study. Research. Business. Global. Alumni. . 12,000 We have over 12,000 students, from over 100 countries, within one of the safest campuses in the UK. 97% 97% of Lancaster students go into work or further study within six months of graduating. Our Colleges. Visiting Campus. News & Media. Contact & Getting Here. About Us. Faculties & Departments. Current Students. Current Staff. Site Search. Search. Quick Links A-Z index About Us Contact Getting Here Current Staff Current Students Faculties Departments Feedback Job Opportunities My eLearning News Media Sitemap Term Dates The Colleges. Go. Find a course. Home. Research. Publications Outputs. The identification of maize lines with contrast... Research. Research at Lancaster. Researchers. Departments Centres. Publications Outputs. Projects. Activities. View graph of relations. Links. http://www.informaworld.com/smpp/content~content=a713731519~db=all~order=page. Text available via DOI:. 10.1081/PLN-200055586. « Back. The identific...
http://research.lancs.ac.uk/portal/en/publications/the-identification-of-maize-lines-with-contrasting-responses-to-applied-nitrogen(e3d50a40-97f5-4eed-9426-705ffc657a01).html
*  Corn hybrid selectio... | Corn Production | Agriculture
Corn Production. Machinery Insider. Crops news Livestock news Policy news Business news Technology news Markets. Crops. Corn Soybeans Wheat Cotton Other Crops Organic Farming Fertilizers Pesticides Grain storage Tillage Renewable Energy Crop Tech Corn High Yield Team Cover Crops Agronomy Insider. Markets Crops Machinery Livestock Farm Management Family and Farm Safety Weather Products Successful Farming. Successful Farming editors Farm Business Farm Production Farm Family Machinery Show. Home / Crops / Corn / Corn Production / Corn hybrid selection checklist. What can this year's corn crop teach you for next year. Acceptable hybrids for your farm are those that exhibit high yields over a wide variety of growing conditions. The hybrid doesn't have to win every trial, but it should be near the top of all of them." Look for your seed company's published variety trial data, as well as university yield information, like Purdue's Crop Performance Program, Nielsen says. Talk: What factors do you consider when buying...
http://agriculture.com/crops/corn/production/cn-hybrid-selection-checklist_137-ar20140
*  ARS | Publication request: Variation among Physical, Compositional, and Wet-Milling Characteristics
Publication request: Variation among Physical, Compositional, and Wet-Milling Characteristics of the F1 Generation of Corn Hybrids of Introgressed Exotic and Adapted Inbred Lines ARS : Research. Title: Variation among Physical, Compositional, and Wet-Milling Characteristics of the F1 Generation of Corn Hybrids of Introgressed Exotic and Adapted Inbred Lines Authors. Variation among Physical, Compositional, and Wet-Milling Characteristics of the F1 Generation of Corn Hybrids of Introgressed Exotic and Adapted Inbred Lines. For wet milling, previously we found that GEM lines and their experimental hybrids of the F1 or seed generation could have similar or better starch yield and starch recovery than Corn Belt checks after laboratory wet milling. Our objective was to evaluate wet milling traits of the F2, or grain generation that would be harvested by the farmer, of the experimental hybrids of GEM lines crossed to three Corn Belt tester lines. Similar to the F1 generation there was great variation found in wet m...
http://ars.usda.gov/research/publications/Publications.htm?seq_no_115=245006
*  Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 - Zea mays (Maize)
Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 - Zea mays Maize. p>An evidence describes the source of an annotation, e.g. an experiment that has been published in the scientific literature, an orthologous protein, a record from another database, etc. /p> p> a href="/manual/evidences">More… /a> /p>. Skip Header. UniProtKB. x UniProtKB Protein knowledgebase UniParc Sequence archive Help Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef Sequence clusters Proteomes Protein sets from fully sequenced genomes Annotation systems Systems used to automatically annotate proteins with high accuracy: UniRule Manually curated rules. SAAS System generated rules. Supporting data Select one of the options below to target your search: Literature citations. Taxonomy. Keywords. Subcellular locations. Cross-referenced databases. Human diseases. Advanced Search. x Searching in. Home. BLAST. Align. Retrieve/ID mapping. Contact. Help. You are usi...
http://uniprot.org/uniprot/B6U0V3
*  doiSerbia - Issue
Variability of vineyard peach tree characteristics Zec Gordan, Čolić Slavica, Marinković Dejan, Nikolić Dragan Genetika, 2008 40 1 :1-7 Details Full text 99 KB DOI:10.2298/GENSR0801001Z The main seed storage proteins among high-protein soybean genotypes Taški-Ajduković Ksenija, Đorđević Vuk, Vidić Miloš, Vujaković Milka, Milosević Mirjana, Miladinović Jegor Genetika, 2008 40 1 :9-16 Details   Cross Ref cited by 1. Full text 119 KB DOI:10.2298/GENSR0801009T Breeding and genetic properties of the maize variety Uzbekska bela Kojić Lazar, Ajgozina Dillyara Genetika, 2008 40 1 :17-21 Details Full text 247 KB DOI:10.2298/GENSR0801017K Divergence in the dry bean collection by Principal Component Analysis PCA Vasić Mirjana, Gvozdanović-Varga Jelica, Červenski Janko Genetika, 2008 40 1 :23-30 Details   Cross Ref cited by 2. Full text 146 KB DOI:10.2298/GENSR0801023V Evaluation of wheat Rht genes using molecular markers Tošović-Marić Biljana, Kobiljski Borislav, Obreht Dragana, Vapa Ljiljana Genetika, 2008 40 1...
http://doiserbia.nb.rs/(X(1)A(0ByLzh420QEkAAAAMDFiMDQ0NzYtMjc3YS00YTc2LWEzOGQtNmI2M2I4YjhhZTkyi_gVW9ho26_OIdZwsH8c2hw5Dyw1))/issue.aspx?issueid=490&AspxAutoDetectCookieSupport=1
*  Get The Most Of Your Corn Crop
... Mon, 2012-08-06 02:51 How will you manage your corn crop this year. Click here for more drought management resources. dsc0071.jpg. I m counting my blessings, as we got a shot of rain last week. Even though it was hardly enough to get the ground wet, I will take any moisture we can get in this epic drought that is impacting 56% of the nation. Travel down most gravel roads around here and many parts of the nation, and you ll notice corn that s scorched from the sun, with hardly an ear in sight. Much of it is turning golden brown already, and I ve heard reports that some farmers are already combining, baling or cutting the corn for silage. I think one of the key things that any farmer needs to consider before making a decision on his crop -- whether to save it for harvest or to use it for livestock feed -- is to evaluate the yield potential. Because of these high prices, using corn for livestock feed could be a mistake. Assess the crop for yield potential to make a more informed decision, and if you do sell...
http://beefmagazine.com/print/blog/get-most-your-corn-crop?group_id=2173
*  Smallest Corn Crop in Six Years Better Than Worst Fears
... News. Video. Video. Asia Video. Europe Video. CNBC U.S. CNBC Europe. CNBC World. Market Insider with Patti Domm Smallest Corn Crop in Six Years Better Than Worst Fears Jane Wells. 10:49 AM ET CNBC.com. The latest numbers from the USDA firm up the outlook for this year's corn crop, and the final numbers may not be as bad as some feared. Despite the worst drought in half a century, the government only slightly reduced total projected production for the year to 10.72 billion bushels. That would be a 13 percent drop from last year and the smallest crop since 2006. However, many analysts expected that number to drop to 10.3 billion, and many farmers feared the numbers could go even lower. Anticipated yield is now expected to average 122.8 bushels an acre, down from 123.4 bushels an acre estimated last month and way below the 166 bu/ac forecasted earlier this year. He and other farmers are harvesting their corn earlier than usual, even though the corn isn't as dry as they'd like it to be. Corn "is not worth an...
http://cnbc.com/id/49003355
*  Plains Area : Products & Services
... ARS Home. About ARS. ARS Research. Research Projects. Scientific Manuscripts. Scientific Software/Models. ARS People Locations. Find a location. Find an office at headquarters. ARS Newsroom. ARS Careers. Careers at ARS Info. Site Map. You are here: Plains Area Home / Services / index. Related Topics Publications. ARS Manuscripts. Search for a publication. ARS Software. Plains Area Safety and Occupational Health Office. Careers Jobs in ARS. Publications at this Location. Listed below are the publications from research projects conducted at this location. Clicking on a publication title will take you to more information on the publication. Clicking on the reprint icon will take you to the publication reprint. 2012 Publications listed by order of acceptance date. Current View: All Publications Show All Publications |. Peer Reviewed Journal Publications Only Displaying 1 to 20 of 797 Records. Deep sequencing of immune repertoires during bovine development and in response to respiratory pathogen challenge Abs...
http://ars.usda.gov/Services/Services.htm?modecode=30-00-00-00&filteryear=2012
*  Hominy
File:Dried Maize Mote from Oaxaca.png|thumb|right|Dried uncooked form of hominy '' US Quarter and Mexican 1 peso coins pictured for size comparison. '''Hominy''' is a food which consists of dried maize kernels which have been treated with an alkali in a process called nixtamalization. Production Recipes See also References. To make hominy, field corn maize grain is dried, then treated by soaking and cooking the mature hard grain in a dilute solution of lye , slaked lime calcium hydroxide or wood ash , a process termed nixtamalization. The soaked maize is washed, and then ground into masa. As a result, while cornmeal made from untreated ground corn is unable by itself to form a dough with the addition of water, the chemical changes in masa allow dough formation, which is essential to the ability to fashion dough into tortillas. Also, soaking the corn in lime. The process of making hominy is also called nixtamalization and the ground product can be called masa nixtamalera. In Central American and Mexican cuisin...
https://en.wikipedia.org/wiki/Hominy
*  D8 - DELLA protein DWARF8 - Zea mays (Maize)
/p> p> a href='../manual/annotation score' target=' top'>More... /p> p> a href='../manual/protein existence' target=' top'>More... /p> p> a href='../manual/function section' target=' top'>More... regulation of transcription, DNA-templated Source: UniProtKB-KW. transcription, DNA-templated Source: UniProtKB-KW. p>UniProtKB Keywords constitute a a target=" top" href="/keywords">controlled vocabulary /a> with a hierarchical structure. p> a href='/help/keywords' target=' top'>More... p>UniProtKB Keywords constitute a a target=" top" href="/keywords">controlled vocabulary /a> with a hierarchical structure. p> a href='/help/keywords' target=' top'>More... /p> p> a href='../manual/names and taxonomy section' target=' top'>More... /p> p> a href='../manual/protein names' target=' top'>More... br />The component name refers to the genomic component encoding a set of proteins. p>UniProtKB Keywords constitute a a target=" top" href="/keywords">controlled vocabulary /a> with a hierarchical structure. Cur...
http://uniprot.org/uniprot/Q9ST48
*  A Modern Herbal | Corn, Indian
A Modern Herbal. Corn, Indian. Botanical.com Home Page. . Corn, Indian Zea Mays Click on graphic for larger image. Corn, Indian. Botanical: Zea Mays LINN. Family: N.O. Graminaceae. Description Constituents Medicinal Action and Uses Other Species ---Synonym--- Maize. ---Part Used--- Seeds. ---Habitat--- South America; also cultivated in other parts of America, in the West Indian Islands, Australia, Africa, India, etc., and now in France. ---Description--- A monoecious plant. Male flowers in terminal racemes; spikelets, two-flowered glumes nearly equal, herbaceous, terminating in two sharp points; females, axillary in the sheaths of the leaves. The spikes or ears proceed from the stalls at various distances from the ground, and are closely enveloped in several thin leaves, forming a sheath called the husk; the ears consist of a cylindrical substance, a pith called the cob; on this the seeds are ranged in eight rows, each row having thirty or more seeds. From the eyes or germs of the seeds proceed individual fil...
http://botanical.com/botanical/mgmh/c/corni103.html
*  Looking for maize RNA or tissues
... walter messier wmessier at genoplex com mon mar est next message mutant mapping responses messages sorted by hello all we are need of good quality rnas from maize variety b preferably we would like a selection of maize tissues that were harvested on liquid nitrogen and stored at c so that we can isolate rna ourselves ideally these rnas or tissues would represent a number of developmental stages but at the very least we need samples from mature plants can anyone point me to a source your assistance is greatly appreciated walter messier ph d director evolutionary genomics llc n broadway denver co phone ext fax email wmessier at genoplex com next message mutant mapping responses messages sorted by more information about the maize mailing list...
http://bio.net/bionet/mm/maize/2001-March/000915.html
*  Jumping gene enabled key step in corn domestication
... UW-Madison Home. News from UW-Madison. UW-Madison > News > Jumping gene enabled key st... Jumping gene enabled key step in corn domestication. Corn split off from its closest relative teosinte, a wild Mexican grass, about 10,000 years ago thanks to the breeding efforts of early Mexican farmers. Today it's hard to tell that the two plants were ever close kin: Corn plants stand tall, on a single sturdy stalk, and produce a handful of large, kernel-filled ears. 25 on the Nature Genetics website, a major change occurred about 23,000 years ago, when a small piece of DNA a jumping gene known as Hopscotch inserted itself into the control region of a teosinte gene that affects plant architecture. "Hopscotch cranked up the gene's expression, which helped the plant produce larger ears with more kernels, plus become less branchy, and so those early farmers picked plants with the Hopscotch to breed," says University of Wisconsin-Madison plant geneticist John Doebley, a corn evolution expert who led the team. In corn...
http://news.wisc.edu/19804
*  Organ Damage In Rats From Monsanto GMO Corn - Slashdot
... Slashdot. Stories. Firehose. All. Popular. Polls. Video. Jobs. Deals Submit. Search Slashdot. Login. or. Sign up. Topics:. Devices. Build. Entertainment. Technology. Open Source. Science. YRO. Follow us:. RSS. Facebook. Google+. Twitter. Newsletter. Catch up on stories from the past week and beyond at the Slashdot story archive. Nickname:. Password:. Public Terminal Forgot your password. Close. binspam dupe notthebest offtopic slownewsday stale stupid fresh funny insightful interesting maybe offtopic flamebait troll redundant overrated insightful interesting informative funny underrated descriptive typo dupe error. 8592376 story. Organ Damage In Rats From Monsanto GMO Corn. 766 Posted by kdawson on Wednesday January 13, 2010 @09:16AM from the ditch-the-high-fructose-corn-syrup dept. jenningsthecat writes "A study published in December 2009 in the International Journal of Biological Sciences found that three varieties of Monsanto genetically-modified corn caused damage to the liver, kidneys, and other org...
http://science.slashdot.org/story/10/01/13/0328221/Organ-Damage-In-Rats-From-Monsanto-GMO-Corn
*  Corn production meeting market demands | [primary-term] content from Southeast Farm Press
Corn production meeting market demands. Home > Corn production meeting market demands Corn production meeting market demands Oct 2, 2006 Southeast Farm Press. Department of Agriculture’s USDA August Cattle on Feed report, which indicates 15 percent more cattle were placed on grain rations in August 2006 compared with last August, the National Corn Growers Association NCGA emphasizes its producers are more than adequately meeting the demands of all markets — feed, food, fuel and exports. More than 2 million cattle were placed on grain rations in August, 15.4 percent more than August 2005. While this may have some negative impact on ranchers, Bill Chase, chairman of NCGA’s Production and Stewardship Action Team, said higher cattle placements and the feeder placements will increase the domestic demand for corn and distillers dried grains DDGs. “The feeder usage of the two ensures there will be sufficient corn to meet all domestic needs, even in a drought year.” Chase also noted corn growers are meeting deman...
http://southeastfarmpress.com/corn-production-meeting-market-demands
*  Frankford Arsenal Brass Cleaning Media Treated Corn Cob 4-1/2 lb Jug
... Shop. Just About Everything for Shooting, Reloading, Gunsmithing and Hunting Skip To Main Content Skip To Site Navigation Search. search. Search Sign In My Account. My Account. Sign In. New Customer. Create Account. Cart. Nitro Express Shipping. Super-Fast, Low-Cost. Up to $15 off your first order. Get Promo Code Reloading Supplies. Case Cleaning Preparation. Case Tumblers, Media Polish. Case Tumbler Media. Frankford Arsenal Brass Cleaning Media Treated Corn Cob 4-1/2 lb Jug Product #: 415585. Frankford Arsenal #: 194524. UPC #: 661120448310. Loading image... X Enlarge. Zoom in. $16.99 List Price: $19.99 Save $3.00 15%. Status:. Available Ships tomorrow from MidwayUSA. Email this Page to a Friend. Quantity:. Add to Cart Add to Wish List. Please Sign In to use this feature. Information. Frankford Arsenal Treated Corn Cob Brass Cleaning Media has been designed to quickly and efficiently remove dirt, grit and powder residue from brass cases before reloading to keep reloading dies in top working condition. M...
http://midwayusa.com/product/415585/frankford-arsenal-brass-cleaning-media-treated-corn-cob-4-1-2-lb-jug?cm_vc=subv1
*  Pit Bull Talk • View topic - Ruby ate a corn cob
Pit Bull Talk View topic - Ruby ate a corn cob. Skip to content. Board index. The Dogs. Nutrition Health. Search. Change font size. FAQ. Register. Login. Ruby ate a corn cob. Food, Fitness and how to keep them healthy. Post a reply. 34 posts. Page 1 of 2. 1, 2. by HappyPuppy. May 14th, 2007, 11:11 pm How dumb was I in just tossing Ruby an eaten corn cob from dinner. Somehow I stupidly thought she'd gnaw on it a few times like a bone and then all of a sudden it was gone...all eaten. Should I try to counter act it with anything. Aaah - by the time most of you east coasters read this it will be morning.... HappyPuppy. Supremely Bully. Posts: 1019. Location: Costa Mesa, CA. Top. by Malli. May 15th, 2007, 12:30 am well, I'd almost say induce vomiting, but if she swallowed it whole theres a chance it might choke her on the way back up. If you get this tonight, try calling an emergency vet to see what they have to say... other then that, watch her closely, if she seems at all lethargic, has a sore belly, goes off he...
http://pitbulltalk.com/viewtopic.php?p=135055
*  Pedigree for Nonhelema Cornstalk (2) - Genealogy
pedigree for nonhelema cornstalk genealogy menu home search all articles people images sources places list people contributions add article person family image mysource source transcript repository place user page other page import gedcom my relate dashboard network watchlist user profile talk page trees show duplicates launch fte admin recent changes nominate logs new images review needed gedcom review speedy delete names log browse pages compare pages special pages personal tools sign in create account donate volunteer help contents search faq support portals watercooler suggestions pedigree for nonhelema cornstalk birth death more husband wife marriage children more more b d retrieved from http www werelate org wiki special showpedigree privacy policy about werelate disclaimers...
http://werelate.org/w/index.php?title=Special:ShowPedigree&pagetitle=Person:Nonhelema_Cornstalk_(2)
*  Patent US5278011 - Reversible optical information-recording medium - Google Patents
Phase-change type, reversible optical information recording medium, being possible for recording, reproducing, erasing, and rewriting of information, by use of a laser beam. Reversible optical information-recording medium US 5278011 A Abstract Phase-change type, reversible optical information recording medium, being possible for recording, reproducing, erasing, and rewriting of information, by use of a laser beam. As the fifth point, sufficiently high crystallization temperature to keep an amorphous state stable could be obtained through the broad range of composition in the system of GeTe-Sb 2 Te 3 /or Bi 2 Te 3. EXAMPLE 5 The cyclability of disk equipped with the film of ternary elements system, Te 58 Ge 12 Sb 30 and the film of quaternary elements system, Te 48 Ge 12 Sb 30 Se 10 as a disk with typical composition were investigated by the same method as adopted in Example 4. As for the former disk, the results of the initial C/N of 53 dB and the C/N of 51 dB after 10 5 time repeating were obtained by repeat...
http://google.com/patents/US5278011?dq=U.S. Patent No. 4,528,643
*  Zea mays ( Buckeye Sweet Corn )
Articles Alpine Garden Annual Garden Bog Garden Bulbs Chihuly Garden Catalogs Compost Common Names Container Garden Dry Garden Easy Veggie Garden Encyclopedia Fence Designs Greenhouse Garden Blog Garden Forums Garden Fountains Garden Designs Garden Guide Garden Plans Garden Videos Garden Words Gardening Tips Garden Webcam Hardiness Zones Herb Garden How to Garden Insects Lawn Care My Garden Perennial Garden Plant Buddy Plant Disease Plant Finder Plant Info Plant This. Poems Verses Propagation Pumpkins Rose Garden Potting Soil Mix Organic Garden Seeds Shade Garden Trees Tomatoes Vegetable Garden Water Garden Donations Please Campfire Songs Search Reference. Corn needs rich soil, full sun and adequate moisture to produce good ears. Light Range: Sun to Full Sun. pH Range: 5.5 to 7.5. Water Range: Normal to Moist. Controlled, slow-release fertilizers are worked into the soil ususally only once during the growing season or per label directions. Conditions : Light Conditions Unless a site is completely exposed, lig...
http://backyardgardener.com/plantname/pda_01be.html
*  Oksusucha
... oksusu cha literally corn tea is a traditional korea n infusion made from boiled roasted corn kernels at doosan encyclopedia the variety of corn most often used is called gang naeng i 강냉이 which is usually grown in the area of gangneung a city in the gangwon province on south korea s eastern coast thus making this drink particularly popular in that region to prepare oksusu cha corn kernels are thoroughly dried and then roasted until they turn golden brown or brown then the roasted corn is brewed with boiling water until the drink s color turns a pale yellow the tea is then strained and the boiled corn discarded roasted corn is available at markets and in prepared tea bags as well maekyung retrieved although the drink is naturally sweet sugar may be added to oksusu cha if a sweeter flavor is desired oksusu cha is often combined with bori cha roasted barley tea as the corn s sweetness offsets the slightly bitter flavor of the barley oksusu cha is traditionally thought to be good for those with high blood pr...
https://en.wikipedia.org/wiki/Oksusucha
*  Using Infrared To See If You're Lit - Businessweek
... Bloomberg the Company its Products. Bloomberg. Company. Careers. Technology. Service Center. Bloomberg Business. Industry Products. Bloomberg Law/BNA. Bloomberg Big Law. Bloomberg New Energy Finance. Bloomberg Content Service. News. Video. Global. Technology. Businessweek. Stocks. Magazine. Video. Designed by Albuquerque-based TruTouch Technologies, a spin-off of InLight Solutions, the test should go on sale next year, first to law enforcement agencies and later for workplace testing. VeraLight, another InLight spin-off, adapted the same core technology to help diagnose diabetes using fluorescent light instead of infrared. Powerful blasts of sound can help squeeze energy out of corn kernels more quickly than today's strictly mechanical approach, say Iowa State University researchers. In tests, mashed corn kernels were passed through a doughnut-shaped device that emits high-energy ultrasonic sound waves. The sound treatment yields sugar at a rate that's 30%-40% faster than today's purely mechanical method...
http://bloomberg.com/bw/stories/2006-07-02/using-infrared-to-see-if-youre-lit
*  Drought hurt world crops less than many had feared: USDA - Reuters News 9/12/2012 4:51 PM
Townhall Radio News. Radio News. Bearing Arms. Townhall. harvest off to a fast start, the Agriculture Department said the country's corn crop would be the smallest in six years and the soybean crop would be the smallest in nine years. Good said high prices are needed to stretch the crop through the marketing year. USDA lowered its forecast of the corn crop by less than 1 percent and the soybean crop by 2 percent. Traders had expected a 3.7 percent reduction in corn and a 1 percent cut in soybeans. CORN CROP BRINGS HUGE CUT IN USE This is the third disappointing corn crop in a row, with production down by 18 percent from 2009's record crop. Corn use by exporters, ethanol plants and livestock feeders will drop by 9 percent this marketing year because of the short crop, USDA said, on top of a 5.5 percent contraction last year. World wheat supplies are only marginally lower despite the losses, USDA said, and feed grain production also is down less than 1 percent, compared with August forecasts. The world wheat cr...
http://townhall.com/news/us/2012/09/12/drought_hurt_world_crops_less_than_many_had_feared_usda
*  Nixtamalization
Image:Tortilleras Nebel.jpg thumb|right|200px|Bowl of hominy nixtamalized corn kernels 'Nixtamalization' IPA: typically refers to a process for the preparation of maize corn, or other grain, in which the grain is soaked and cooked in an alkaline solution, usually limewater, and hulled. 1 As a result, while cornmeal made from untreated ground corn is unable by itself to form a dough on addition of water, the chemical changes in masa allow dough formation. These benefits make nixtamalization a crucial preliminary step for further processing of maize into food products, and the process is employed using both traditional and industrial methods, in the production of tortilla s and tortilla chip s but not corn chip s, tamale s, hominy and many other items. Europe, Africa, and India. Process Enzymatic nixtamalization. The nixtamalization process was very important in the early Mesoamerican diet, as unprocessed maize is deficient in free niacin. Maize cooked with lime provided niacin in this diet. Europe, Africa, and...
https://en.wikipedia.org/wiki/Nixtamalization
*  Wet-milling
wet milling wet milling wet milling is a process in which feed material is steeped in water with or without sulfur dioxide to soften the seed kernel in order to help separate the kernel s various components for example wet milling plants can separate a pound bushel of corn into more than pounds of cornstarch which in turn can be converted into corn syrup s or corn ethanol pounds of corn gluten meal for use in animal feed and nearly pounds of corn oil see also corn steep liquor references category solid solid separation...
https://en.wikipedia.org/wiki/Wet-milling
*  Portal:Gardening/Selected picture/6
portal gardening selected picture portal gardening selected picture selected picture image corncobs jpg size px caption corn cobs gallery location text maize zea mays l ssp mays known as corn in the americas and australia is a cereal grain that was domesticated in mesoamerica and then spread throughout the american continents maize spread to the rest of the world after the european colonization of the americas in the late th century and early th century credit asbestos link maize...
https://en.wikipedia.org/wiki/Portal:Gardening/Selected_picture/6
*  How do I rerun a kernel with a new data set?
How do I rerun a kernel with a new data set. How do I rerun a kernel with a new data set. Printable View. 06-19-2012, 01:48 AM biokhar How do I rerun a kernel with a new data set. I have a kernel that I successfully setup and ran, but I want to take the results of that kernel run, then rerun the kernel with a new data set 40,000 times. Is it possible to replace the GPU memory with a new data set without repeating the whole setup process creating context, commandQueue, program, kernel, memory buffer, kernel arguments. My kernel takes 5 arrays and calculates a score. Then I read the score back to the CPU. Using the score, I change one of the arrays and I want to rerun the kernel with the changes. How do I reset the array on the GPU. 06-19-2012, 08:20 AM Jan23 Re: How do I rerun a kernel with a new data set. If you want to call a Kernel several times using a loop, you can do most things just once, before the loop. This includes creating context, queue, kernel, and program. Also, the creation of those memory buff...
https://khronos.org/message_boards/printthread.php?t=8385&pp=10&page=1
*  https://www.ttuhsc.edu/Health.edu/(S(mthsts45u5ja3z555g3kzm45))/individualsubscriptions.aspx
... => https://www.ttuhsc.edu/Health.edu/(S(mthsts45u5ja3z555g3kzm45))/1810;url=/Health.edu/(S(mthsts45u5ja3z555g3kzm45))/SignOut.aspx?auto=true...
https://ttuhsc.edu/Health.edu/(S(mthsts45u5ja3z555g3kzm45))/individualsubscriptions.aspx
*  GO:0033663 negative regulation by symbiont of host defense-related protein level
Ontology Biological Process. Definition Any process in which the symbiont stops or reduces of the levels of defense-related proteins in its host. Database. Database. ENSEMBL TranscriptID Ensembl database of automatically annotated genomic data. You can apply multiple filtering parameters to restrict the set of annotations to those that match, for example: a list of gene/protein identifiers ID gene products from specified taxonomic groups Taxon annotations that apply certain Qualifier types those that are supported by a particular Reference or Evidence type those that use a particular source of external annotation data annotations that have been supplied by a particular GO annotation group. Gene Product ID proteinID Currently selected additional filtering parameters:. EnsemblFungi:* Ensembl Fungi, the Ensembl Genomes database for accessing fungal genome data. EnsemblPlants:* Ensembl Plants, the Ensembl Genomes database for accessing plant genome data. EnsemblFungi Ensembl Fungi, the Ensembl Genomes database fo...
http://ebi.ac.uk/QuickGO/GTerm?id=GO:0033663
*  Global Measurement of Turnover of Plant Proteins | Minnesota Supercomputing Institute
Global Measurement of Turnover of Plant Proteins. Minnesota Supercomputing Institute. Search Search. Minnesota Supercomputing Institute. Getting Started Help & Documentation Services Proposal Support Systems News & Events Research @ MSI About. Getting Started Services Systems Research Help & Documentation News & Events About Proposal Support System Status. Get Access to MSI Quick Start Guides MSI Tutorials Help & Documentation. Software Queues MSI Tutorials Computer & Visualization Labs FAQ Services. HPC Interactive HPC Consultation Portals and Databases Data Storage Proposal Support Systems. HPC Interactive HPC Data Storage Specialized Hardware News & Events. MSI News Events Research @ MSI. Global Measurement of Turnover of Plant Proteins. Abstract: Global Measurement of Turnover of Plant Proteins. The objectives of this research are to develop robust methods for stable isotope labeling of plant proteins for the purpose of determination of absolute rates of turnover the half-life for a wide number of differe...
https://msi.umn.edu/content/global-measurement-turnover-plant-proteins
*  ExRx.net • View topic - plant proteins
ExRx.net View topic - plant proteins. . ExRx.net Exercise Prescription on the Net. Login. Search. It is currently Sun Oct 04, 2015 7:49 am. View unanswered posts. View active topics Board index. Forums. Diet Nutrition All times are UTC - 6 hours. plant proteins Moderators: Jungledoc, Ironman, stuward. Page 1 of 1. Print view Previous topic. Next topic. Author Message leif3141 Post subject: plant proteins Posted: Thu Jul 13, 2006 1:05 pm. Apprentice. Joined: Mon Dec 26, 2005 10:17 pm Posts: 124 Location: ohio, USA Just out of curiousity...I know you must combine plant proteins to make them complete, but which do you combine with which. I think its grains and beans or vegetable with seeds...but not sure. Anyone know. Top. TimD Post subject:. Posted: Thu Jul 13, 2006 1:36 pm. In Memoriam: TimD. Joined: Mon Dec 19, 2005 8:04 am Posts: 3129 Location: Va Beach, Va Grains and legumes seem to compliment each other nicely, HOWEVER, nutritionist's disagree with this, but the nutritionists with a sports nutrition backgr...
http://exrx.net/forum/viewtopic.php?p=5658
*  Category:Plant proteins
category plant proteins category plant proteins plant proteins category plant physiology category proteins by type of organism...
https://en.wikipedia.org/wiki/Category:Plant_proteins
*  Moving plant proteins
... redirect motor protein...
https://en.wikipedia.org/wiki/Moving_plant_proteins

Southern corn leaf blight: Southern corn leaf blight (SCLB) is a fungal disease of maize caused by the plant pathogen Bipolaris maydis (also known as Cochliobolus heterostrophus in its teleomorph state).Mucigel: Mucigel is a slimy substance that covers the root cap of the roots of plants. It is a highly hydrated polysaccharide, most likely a pectin, which is secreted from the outermost (epidermal) cells of the rootcap.Endodermis: The endodermis is the central, innermost layer of cortex in some land plants. It is made of compact living cells surrounded by an outer ring of endodermal cells that are impregnated with hydrophobic substances (Casparian Strip) to restrict apoplastic flow of water to the inside.Squamosa promoter binding protein: The SQUAMOSA promoter binding protein-like (SBP or SPL) family of transcription factors are defined by a plant-specific DNA-binding domain. The founding member of the family was identified based on its specific in vitro binding to the promoter of the snapdragon SQUAMOSA gene.Tomato seed oil: Tomato seed oil is a vegetable oil extracted from the seeds of tomatoes.Canna Leaf Roller: Cannas are largely free of pests, but in the USA plants sometimes fall victim the Canna Leaf Roller, which can actually be two different insects. Larva of the Brazilian skipper butterfly (Calpodes ethlius), also known as the Larger Canna Leaf Roller, cut the leaves and roll them over to live inside while pupating and eating the leaf.Zein: Zein is a class of prolamine protein found in maize (corn). It is usually manufactured as a powder from corn gluten meal.Coles PhillipsAuxin binding protein: In molecular biology, the auxin binding protein family is a family of proteins which bind auxin. They are located in the lumen of the endoplasmic reticulum (ER).Dikinase: Dikinases are a category of enzymes that catalyze the chemical reactionTriacetic acid lactonePlant perception (physiology): Plant perception is the ability of plants to sense and respond to the environment to adjust their morphology, physiology and phenotype accordingly. Other disciplines such as plant physiology, ecology and molecular biology are used to assess this ability.PollenPlant breeders' rights: Plant breeders' rights (PBR), also known as plant variety rights (PVR), are rights granted to the breeder of a new variety of plant that give the breeder exclusive control over the propagating material (including seed, cuttings, divisions, tissue culture) and harvested material (cut flowers, fruit, foliage) of a new variety for a number of years.Chance seedling: A chance seedling is a plant that is the product of unintentional breeding. It may be a genetically unique individual with desirable characteristics that is then intentionally bred.Placental cotyledon: In human development, the cotyledons are the approximately 15-25 separations of the decidua basalis of the placenta, separated by placental septa.Page 565 in: Each cotyledon consists of a main stem of a chorionic villus] as well as its branches and subbranches etc.Anthocyanin 5-O-glucosyltransferase: Anthocyanin 5-O-glucosyltransferase is an enzyme that forms anthocyanin 3,5-O-diglucoside from anthocyanin 3-O-glucoside.AmyloplastIndex of soil-related articles: This is an index of articles relating to soil.Protein primary structure: The primary structure of a peptide or protein is the linear sequence of its amino acid structural units, and partly comprises its overall biomolecular structure. By convention, the primary structure of a protein is reported starting from the amino-terminal (N) end to the carboxyl-terminal (C) end.Weedy rice: Weedy rice, also known as red rice, is a variety of rice (Oryza) that produces far fewer grains per plant than cultivated rice and is therefore considered a pest. The name "weedy rice" is used for all types and variations of rice which show some characteristic features of cultivated rice and grow as weeds in commercial rice fields.Inbreeding depression: Inbreeding depression is the reduced biological fitness in a given population as a result of inbreeding, or breeding of related individuals. Population biological fitness refers to its ability to survive and reproduce itself.Paddock: A paddock has two primary meanings in different parts of the English-speaking world. In Canada, the USA and UK, a paddock is a small enclosure used to keep horses.Branching order of bacterial phyla (Gupta, 2001): There are several models of the Branching order of bacterial phyla, one of these was proposed in 2001 by Gupta based on conserved indels or protein, termed "protein signatures", an alternative approach to molecular phylogeny. Some problematic exceptions and conflicts are present to these conserved indels, however, they are in agreement with several groupings of classes and phyla.Symmetry element: A symmetry element is a point of reference about which symmetry operations can take place. In particular, symmetry elements can be centers of inversion, axes of rotation and mirror planes.Phaseic acidStarch gelatinization: Starch gelatinization is a process of breaking down the intermolecular bonds of starch molecules in the presence of water and heat, allowing the hydrogen bonding sites (the hydroxyl hydrogen and oxygen) to engage more water. This irreversibly dissolves the starch granule in water.Humic acid: Humic acid is a principal component of humic substances, which are the major organic constituents of soil (humus), peat and coal. It is also a major organic constituent of many upland streams, dystrophic lakes, and ocean water.PomalidomideFujiyama (roller coaster)LeucoplastComposite transposon: A composite transposon is similar in function to simple transposons and Insertion Sequence (IS) elements in that it has protein coding DNA segments flanked by inverted, repeated sequences that can be recognized by transposase enzymes. A composite transposon, however, is flanked by two separate IS elements which may or may not be exact replicas.Herbicide: Herbicide(s), also commonly known as weedkillers, are pesticides used to control unwanted plants. Selective herbicides control specific weed species, while leaving the desired crop relatively unharmed.

(1/5543) Cloning and characterization of a maize cytochrome-b5 reductase with Fe3+-chelate reduction capability.

We previously purified an NADH-dependent Fe3+-chelate reductase (NFR) from maize roots with biochemical features of a cytochrome-b5 reductase (b5R) [Sparla, Bagnaresi, Scagliarini and Trost (1997) FEBS Lett. 414, 571-575]. We have now cloned a maize root cDNA that, on the basis of sequence information, calculated parameters and functional assay, codes for NFR. Maize NFR has 66% and 65% similarity to mammal and yeast b5R respectively. It has a deduced molecular mass of 31.17 kDa and a pI of 8.53. An uncharged region is observed at its N-terminus but no myristoylation consensus site is present. Taken together, these results, coupled with previous biochemical evidence, prove that NFR belongs to the b5R class and document b5R from a plant at the molecular level for the first time. We have also identified a putative Arabidopsis thaliana NFR gene. Its organization (nine exons) closely resembles mammalian b5Rs. Several NFR isoforms are expected to exist in maize. They are probably not produced by alternative translational mechanisms as occur in mammals, because of specific constraints observed in the maize NFR cDNA sequence. In contrast with yeast and mammals, tissue-specific and various subcellular localizations of maize b5R isoforms could result from differential expression of the various members of a multigene family. The first molecular characterization of a plant b5R indicates an overall remarkable evolutionary conservation for these versatile reductase systems. In addition, the well-characterized Fe3+-chelate reduction capabilities of NFR, in addition to known Fe3+-haemoglobin reduction roles for mammal b5R isoforms, suggest further and more generalized roles for the b5R class in endocellular iron reduction.  (+info)

(2/5543) Gibberellic acid stabilises microtubules in maize suspension cells to cold and stimulates acetylation of alpha-tubulin.

Gibberellic acid is known to stabilise microtubules in plant organs against depolymerisation. We have now devised a simplified cell system for studying this. Pretreatment of a maize cell suspension with gibberellic acid for just 3 h stabilised protoplast microtubules against depolymerisation on ice. In other eukaryotes, acetylation of alpha-tubulin is known to correlate with microtubule stabilisation but this is not established in plants. By isolating the polymeric tubulin fraction from maize cytoskeletons and immunoblotting with the antibody 6-11B-1, we have demonstrated that gibberellic acid stimulates the acetylation of alpha-tubulin. This is the first demonstrated link between microtubule stabilisation and tubulin acetylation in higher plants.  (+info)

(3/5543) Patterns of evolutionary rate variation among genes of the anthocyanin biosynthetic pathway.

The anthocyanin biosynthetic pathway is responsible for the production of anthocyanin pigments in plant tissues and shares a number of enzymes with other biochemical pathways. The six core structural genes of this pathway have been cloned and characterized in two taxonomically diverse plant species (maize and snapdragon). We have recently cloned these genes for a third species, the common morning glory, Ipomoea purpurea. This additional information provides an opportunity to examine patterns of evolution among genes within a single biochemical pathway. We report here that upstream genes in the anthocyanin pathway have evolved substantially more slowly than downstream genes and suggest that this difference in evolutionary rates may be explained by upstream genes being more constrained because they participate in several different biochemical pathways. In addition, regulatory genes associated with the anthocyanin pathway tend to evolve more rapidly than the structural genes they regulate, suggesting that adaptive evolution of flower color may be mediated more by regulatory than by structural genes. Finally, for individual anthocyanin genes, we found an absence of rate heterogeneity among three major angiosperm lineages. This rate constancy contrasts with an accelerated rate of evolution of three CHS-like genes in the Ipomoea lineage, indicating that these three genes have diverged without coordinated adjustment by other pathway genes.  (+info)

(4/5543) Inhibition of plant-pathogenic fungi by a corn trypsin inhibitor overexpressed in Escherichia coli.

The cDNA of a 14-kDa trypsin inhibitor (TI) from corn was subcloned into an Escherichia coli overexpression vector. The overexpressed TI was purified based on its insolubility in urea and then refolded into the active form in vitro. This recombinant TI inhibited both conidium germination and hyphal growth of all nine plant pathogenic fungi studied, including Aspergillus flavus, Aspergillus parasiticus, and Fusarium moniliforme. The calculated 50% inhibitory concentration of TI for conidium germination ranged from 70 to more than 300 microgram/ml, and that for fungal growth ranged from 33 to 124 microgram/ml depending on the fungal species. It also inhibited A. flavus and F. moniliforme simultaneously when they were tested together. The results suggest that the corn 14-kDa TI may function in host resistance against a variety of fungal pathogens of crops.  (+info)

(5/5543) Natural occurrence of the C series of fumonisins in moldy corn.

We analyzed 44 moldy corn samples for the B and C series of fumonisins by high-performance liquid chromatography. Of the 44 samples, 32 (73%) were contaminated with both the B and C series of fumonisins and 6 were contaminated with only the B series of fumonisins. The incidence of fumonisin C1 in moldy corn was 71%; the incidence was 11% for fumonisin C3 and 43% for fumonisin C4. Their mean levels ranged from 500 to 1,900 ng/g. This is the first report on the natural occurrence of the C series of fumonisins and fumonisin B4 in moldy corn.  (+info)

(6/5543) Relationship between ruminal starch degradation and the physical characteristics of corn grain.

The objectives of this study were to determine the range of variation in the rate and extent of in situ ruminal starch degradation of 14 corns differing in vitreousness and to predict ruminal starch degradability by physical characteristics of corn grains. This study was conducted with eight dent and six flint corns. Ruminal starch degradability was determined by an in situ technique on 3-mm ground grains. Physical characteristics of corn grain were measured: hardness by grinding energy and particle size distribution, apparent and true densities, and specific surface area. Ruminal DM and starch degradabilities averaged 50 and 55.1% and varied from 39.7 to 71.5% and from 40.6 to 77.6%, respectively. Ruminal starch degradability averaged 61.9 and 46.2% in dent and flint types, respectively. The proportion of coarse particles (61.9 vs. 69.6% for dent and flint, respectively), the apparent density (1.29 vs. 1.36 g/cm3 for dent and flint, respectively), and the specific surface area (.13 vs. .07 m2/g for dent and flint, respectively) varied with the vitreousness. Ruminal starch degradability could be predicted accurately by vitreousness (r2 = .89) or by the combination of apparent density and 1,000-grain weight (R2 = .91), a measurement faster than the vitreousness determination.  (+info)

(7/5543) Growth phase-dependent subcellular localization of nitric oxide synthase in maize cells.

A protein band of approximately 166 kDa was detected in the soluble fraction of root tips and young leaves of maize seedlings, based on Western blot analysis using antibodies raised against mouse macrophage nitric oxide synthase (NOS) and rabbit brain NOS. NOS activity was present in these soluble fractions, as determined by L-[U-14C]citrulline synthesis from L[U-14]arginine. Immunofluorescence showed that the maize NOS protein is present in the cytosol of cells in the division zone and is translocated into the nucleus in cells in the elongation zone of maize root tips. These results indicate the existence of a NOS enzyme in maize tissues, with the localization of this protein depending on the phase of cell growth.  (+info)

(8/5543) Characterization of maize (Zea mays L.) Wee1 and its activity in developing endosperm.

We report the characterization of a maize Wee1 homologue and its expression in developing endosperm. Using a 0.8-kb cDNA from an expressed sequence tag project, we isolated a 1.6-kb cDNA (ZmWee1), which encodes a protein of 403 aa with a calculated molecular size of 45.6 kDa. The deduced amino acid sequence shows 50% identity to the protein kinase domain of human Wee1. Overexpression of ZmWee1 in Schizosaccharomyces pombe inhibited cell division and caused the cells to enlarge significantly. Recombinant ZmWee1 obtained from Escherichia coli is able to inhibit the activity of p13(suc1)-adsorbed cyclin-dependent kinase from maize. ZmWee1 is encoded by a single gene at a locus on the long arm of chromosome 4. RNA gel blots showed the ZmWee1 transcript is about 2.4 kb in length and that its abundance reaches a maximum 15 days after pollination in endosperm tissue. High levels of expression of ZmWee1 at this stage of endosperm development imply that ZmWee1 plays a role in endoreduplication. Our results show that control of cyclin-dependent kinase activity by Wee1 is conserved among eukaryotes, from fungi to animals and plants.  (+info)


is zea mays corn starch good for your skin?


i think so


Is "Zea" a suitable name for a girl?


Zea comes from the scientific name of corn "Zea Mays." I like "Zea" because it literally means "grain." I'm not planning on having children anytime soon, but I would like to name a future baby girl "Zea." But, could it be used to name a person? What do you think?
It's pronounced "Zee-uh"
----------

yeah, i think its a great name for a little girl x


Where can I get clothes similar to Jayma Mays character on Glee?


I love her cardigans, skirts, and t shirt sweater things.  I also like her accessories like her necklaces and shoes.  What stores carry similar styles?  
PS i live in Minneapolis, MN so I only have access to stores in my area including mall of america and online websites.
----------

Her style is totally preppy. JCrew has a lot of similar stuff. I actually saw the exact same necklace she wore in one of the episodes being sold at J Crew. Good luck, happy shopping :)


When does a woman ovulating how mays days after her firsty day of her period?


When does a woman oulating after ten days after her period or is 14 days after just make sure.I been ttc for 3 months and i wanted to know when do i ovulating?My first dasy of my period was October 20. So when do i ovulating? Help A.s.A.P
----------

that's a bit backwards - the menstruation is a cleaning cycle that follows ovulation; typically about 14 days after ovulation.

If you have a regular 28 day cycle that would suggest that the next ovulation occurs around 14 days after the beginning of your menstruation. however not everyone's body follows the "typical" cycle. the Menstruation is  ovulation - so if you have an irregular cycle then there is no predicting the next ovulation date based on the dates of the last menstruation.


Would you be happy if your child grew up and was like Billy Mays?


you know that yelling infomercial guy.

i think i would cry.
haha tiger thats good!  i just heard his commercial and started to twitch myself.
----------

OOOOOOOOOOOhhhhhhhhh my wife would so be laughing right now.
when that Billy Mays guy comes on t.v. I close my eyes and clench my fists, start punching pillows, wanting it to end.

If my son turned into that raven haired b@stard....I'd gag him and shave his head and ship him to Cuba.


Anyone know the recipe 4 the hummus at Zea WoodFire Grill (restaurants in TX, LA, AL, NM?


also in FL
----------

I don't know the recipe from Zea..., but here is a good basic recipe for hummus. You can start with this and add other ingredients that there is in their hummus(be creative).
There are 42 hummus recipes on the web page(source), check it, you might find another one you like more.
Good luck :-)


This recipe appears in the Allrecipes "Tried & True Favorites" cookbook.


Hummus III  

Submitted by: Rhoda McIntosh

Rated: 5 out of 5 by 581 members  

Prep Time: 10 Minutes
Ready In: 10 Minutes
Yields: 16 servings 

"As a spread, dip or garlicky pita filling, classic hummus is both delicious and satisfying. Best of all, it's whipped up in seconds in a blender or food processor."

INGREDIENTS:
2 cups canned garbanzo 
beans, drained
1/3 cup tahini
1/4 cup lemon juice
1 teaspoon salt 
2 cloves garlic, halved
1 tablespoon olive oil
1 pinch paprika
1 teaspoon minced fresh parsley 

DIRECTIONS:
1. Place the garbanzo beans, tahini, lemon juice, salt and garlic in a blender or food processor. Blend until smooth. Transfer mixture to a serving bowl. 
2. Drizzle olive oil over the garbanzo bean mixture. Sprinkle with paprika and parsley.


Where can I buy an Oxiclean blue dress shirt like Billy Mays weared?


I'm dressing up as Billy Mays on Halloween but I'm having finding a hard time finding an official Oxiclean blue dress up shirt.  Here are some pics of the shirt on this link:

http://www.doobybrain.com/2009/07/06/pallbearers-at-billy-mays-funeral-wear-oxiclean-blue-shirts/

Hope somone can help!

HI BILLY MAYS HERE!
----------




what mays white cell get high if you are not sick?


had blood work done for a op. came back white cell are high i'm not sick don't have atemp.
----------

Smoking is the most common cause.