Sucrose: A nonreducing disaccharide composed of GLUCOSE and FRUCTOSE linked via their anomeric carbons. It is obtained commercially from SUGARCANE, sugar beet (BETA VULGARIS), and other plants and used extensively as a food and a sweetener.Dietary Sucrose: Sucrose present in the diet. It is added to food and drinks as a sweetener.Centrifugation, Density Gradient: Separation of particles according to density by employing a gradient of varying densities. At equilibrium each particle settles in the gradient at a point equal to its density. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Sweetening Agents: Substances that sweeten food, beverages, medications, etc., such as sugar, saccharine or other low-calorie synthetic products. (From Random House Unabridged Dictionary, 2d ed)beta-Fructofuranosidase: A glycoside hydrolase found primarily in PLANTS and YEASTS. It has specificity for beta-D-fructofuranosides such as SUCROSE.Glucosyltransferases: Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.Taste: The ability to detect chemicals through gustatory receptors in the mouth, including those on the TONGUE; the PALATE; the PHARYNX; and the EPIGLOTTIS.Fructose: A monosaccharide in sweet fruits and honey that is soluble in water, alcohol, or ether. It is used as a preservative and an intravenous infusion in parenteral feeding.Starch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Isomaltose: A disaccharide consisting of two glucose units in an alpha (1-6) glycosidic linkage.Carbohydrate Metabolism: Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.Fructans: Polysaccharides composed of D-fructose units.Food Preferences: The selection of one food over another.SucraseDietary Carbohydrates: Carbohydrates present in food comprising digestible sugars and starches and indigestible cellulose and other dietary fibers. The former are the major source of energy. The sugars are in beet and cane sugar, fruits, honey, sweet corn, corn syrup, milk and milk products, etc.; the starches are in cereal grains, legumes (FABACEAE), tubers, etc. (From Claudio & Lagua, Nutrition and Diet Therapy Dictionary, 3d ed, p32, p277)Cell Fractionation: Techniques to partition various components of the cell into SUBCELLULAR FRACTIONS.Glucaric Acid: A sugar acid derived from D-glucose in which both the aldehydic carbon atom and the carbon atom bearing the primary hydroxyl group are oxidized to carboxylic acid groups.Cariogenic Agents: Substances that promote DENTAL CARIES.Streptococcus mutans: A polysaccharide-producing species of STREPTOCOCCUS isolated from human dental plaque.Maltose: A dextrodisaccharide from malt and starch. It is used as a sweetening agent and fermentable intermediate in brewing. (Grant & Hackh's Chemical Dictionary, 5th ed)Phloem: Plant tissue that carries nutrients, especially sucrose, by turgor pressure. Movement is bidirectional, in contrast to XYLEM where it is only upward. Phloem originates and grows outwards from meristematic cells (MERISTEM) in the vascular cambium. P-proteins, a type of LECTINS, are characteristically found in phloem.Plant Proteins: Proteins found in plants (flowers, herbs, shrubs, trees, etc.). The concept does not include proteins found in vegetables for which VEGETABLE PROTEINS is available.Molecular Weight: The sum of the weight of all the atoms in a molecule.Kinetics: The rate dynamics in chemical or physical systems.Raffinose: A trisaccharide occurring in Australian manna (from Eucalyptus spp, Myrtaceae) and in cottonseed meal.Fructokinases: A class of enzymes that catalyzes the phosphorylation of fructose in the presence of ATP. EC 2.7.1.-.Glycoside HydrolasesSodium Chloride: A ubiquitous sodium salt that is commonly used to season food.TrehaloseHypertonic Solutions: Solutions that have a greater osmotic pressure than a reference solution such as blood, plasma, or interstitial fluid.Taste Threshold: The minimum concentration at which taste sensitivity to a particular substance or food can be perceived.Glucose: A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.Quinine: An alkaloid derived from the bark of the cinchona tree. It is used as an antimalarial drug, and is the active ingredient in extracts of the cinchona that have been used for that purpose since before 1633. Quinine is also a mild antipyretic and analgesic and has been used in common cold preparations for that purpose. It was used commonly and as a bitter and flavoring agent, and is still useful for the treatment of babesiosis. Quinine is also useful in some muscular disorders, especially nocturnal leg cramps and myotonia congenita, because of its direct effects on muscle membrane and sodium channels. The mechanisms of its antimalarial effects are not well understood.Taste Perception: The process by which the nature and meaning of gustatory stimuli are recognized and interpreted by the brain. The four basic classes of taste perception are salty, sweet, bitter, and sour.Microscopy, Electron: Microscopy using an electron beam, instead of light, to visualize the sample, thereby allowing much greater magnification. The interactions of ELECTRONS with specimens are used to provide information about the fine structure of that specimen. In TRANSMISSION ELECTRON MICROSCOPY the reactions of the electrons that are transmitted through the specimen are imaged. In SCANNING ELECTRON MICROSCOPY an electron beam falls at a non-normal angle on the specimen and the image is derived from the reactions occurring above the plane of the specimen.Saccharin: Flavoring agent and non-nutritive sweetener.Carbohydrates: The largest class of organic compounds, including STARCH; GLYCOGEN; CELLULOSE; POLYSACCHARIDES; and simple MONOSACCHARIDES. Carbohydrates are composed of carbon, hydrogen, and oxygen in a ratio of Cn(H2O)n.Aspartame: Flavoring agent sweeter than sugar, metabolized as PHENYLALANINE and ASPARTIC ACID.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Cryoprotective Agents: Substances that provide protection against the harmful effects of freezing temperatures.Disaccharides: Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.Plant Leaves: Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)Culture Media: Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.Osmosis: Tendency of fluids (e.g., water) to move from the less concentrated to the more concentrated side of a semipermeable membrane.Hydrogen-Ion Concentration: The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Saccharum: A plant genus of the family POACEAE widely cultivated in the tropics for the sweet cane that is processed into sugar.Gene Expression Regulation, Plant: Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in plants.Uridine Diphosphate Glucose: A key intermediate in carbohydrate metabolism. Serves as a precursor of glycogen, can be metabolized into UDPgalactose and UDPglucuronic acid which can then be incorporated into polysaccharides as galactose and glucuronic acid. Also serves as a precursor of sucrose lipopolysaccharides, and glycosphingolipids.DextranaseConditioning, Operant: Learning situations in which the sequence responses of the subject are instrumental in producing reinforcement. When the correct response occurs, which involves the selection from among a repertoire of responses, the subject is immediately reinforced.Cell Membrane: The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.Biological Transport: The movement of materials (including biochemical substances and drugs) through a biological system at the cellular level. The transport can be across cell membranes and epithelial layers. It also can occur within intracellular compartments and extracellular compartments.Osmolar Concentration: The concentration of osmotically active particles in solution expressed in terms of osmoles of solute per liter of solution. Osmolality is expressed in terms of osmoles of solute per kilogram of solvent.Glucans: Polysaccharides composed of repeating glucose units. They can consist of branched or unbranched chains in any linkages.TritiumWater: A clear, odorless, tasteless liquid that is essential for most animal and plant life and is an excellent solvent for many substances. The chemical formula is hydrogen oxide (H2O). (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Membrane Transport Proteins: Membrane proteins whose primary function is to facilitate the transport of molecules across a biological membrane. Included in this broad category are proteins involved in active transport (BIOLOGICAL TRANSPORT, ACTIVE), facilitated transport and ION CHANNELS.Electrophoresis, Polyacrylamide Gel: Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.Feeding Behavior: Behavioral responses or sequences associated with eating including modes of feeding, rhythmic patterns of eating, and time intervals.Subcellular Fractions: Components of a cell produced by various separation techniques which, though they disrupt the delicate anatomy of a cell, preserve the structure and physiology of its functioning constituents for biochemical and ultrastructural analysis. (From Alberts et al., Molecular Biology of the Cell, 2d ed, p163)Osmotic Pressure: The pressure required to prevent the passage of solvent through a semipermeable membrane that separates a pure solvent from a solution of the solvent and solute or that separates different concentrations of a solution. It is proportional to the osmolality of the solution.Carbon Isotopes: Stable carbon atoms that have the same atomic number as the element carbon, but differ in atomic weight. C-13 is a stable carbon isotope.

*  Method of producing trehalose by microorganisms which can produce tremalose with sucrose or maltose
tremalose with sucrose or maltose as main carbon source - ... tremalose with sucrose or maltose as main carbon source. ... medium containing sucrose or maltose as an essential carbon ... 2 The method of claim 1, wherein said microorganism is selected from the group consisting of Brevibacterium lactofermentum ATCC 13869, Brevibacterium flavum ATCC 14067, Brevibacterium divaricatum ATCC 21642, Corynebacterium glutamicum ATCC 13032, Corynebacterium acetoacidophilum ATCC 13870, Corynebacterium lilium ATCC 15990, Arthrobacter citreus ATCC 11624, Arthrobacter sulfreus ATCC 15170, Microbacterium ammoniaphilum ATCC 15354. 5 The method of claim 1, wherein said main carbon source is sucrose, and said microorganism is selected from the group consisting of Brevibacterium lactofermentum ATCC 13869, Brevibacterium flavum ATCC 14067, Brevibacterium divaricatum ATCC 21642, Corynebacterium glutamicum ATCC 13032, Corynebacterium acetoacidophilum ATCC 13870, Corynebacterium lilium ATCC 15990, Arthrobacter citreus ATCC 116...
http://freepatentsonline.com/5484714.html
*  Is Sugar a Poison?
to table sugar sucrose and high-fructose corn syrup. While ... like to boast that sucrose and High Fructose Corn Syrup are the ... Here s the deal. Sucrose is 50% glucose 50% fructose. HFCS is ... Is Sugar a Poison. Muscle-Building Diet. Muscle-Building Diet. Free Bodybuilding Meal Plans Book. High-Carb. Low-Carb. NEED MORE MUSCLE FAST. Training is 100% FREE. Is Sugar a Poison. by Mark McManus. on July 26, 2011. To clear something up before we proceed, when Lustig talks about sugar, he s referring to table sugar sucrose and high-fructose corn syrup. While the Corn Refiners Association like to boast that sucrose and High Fructose Corn Syrup are the same in terms of their biological effects, Lustig says that s the whole point: They re both equally POISONOUS. Sucrose is 50% glucose 50% fructose. HFCS is 45% glucose 55% fructose Specifically, Lustig says it is the fructose that is the problem. So what s the problem with fructose. He makes the great point that a high-sugar diet IS a high-fat diet in terms o...
http://musclehack.com/is-sugar-a-poison/
*  Sucrose - Home Brew Forums
Sucrose - Home Brew Forums. Home Brew Forums ... /Ingredients. > Sucrose. Go to Page ... Likes Given: 2. Sucrose. I have come across recipes for ... Home Brew Forums > Home Brewing Beer > Recipes/Ingredients > Sucrose Go to Page... Thread Tools 10-23-2007, 12:45 AM # 1 WormBoy Chief Bottle Washer Feedback Score: 0 reviews Recipes Recipes Join Date: Feb 2007 Location: Islip, New York Posts: 335 Likes Given: 2 Sucrose I have come across recipes for Belgian beers that call for a few pounds of table sugar (hand me down recipes). I have read that the purists tend to use candi sugar instead. But for a complete fermentable, is there anything wrong with using table sugar? Is this yeast junk food? Fermenting: My desire to brew! WormBoy View Public Profile Send a private message to WormBoy Find More Posts by WormBoy 10-23-2007, 12:50 AM # 2 Yuri Rage Gritty. Feedback Score: 0 reviews Recipes Recipes Black Project Stout Pistols 'n Pesos Southwestern Wheat Floor Kill Ale (Maibock...ish) Th...
http://homebrewtalk.com/showthread.php?t=42392
*  Crystallized ascorbic acid (vitamin C) and sucrose | 2005 Photomicrography Competition | Nikon’s S
acid vitamin C and sucrose. 2005 Photomicrography Competition. ... acid vitamin C and sucrose - see: Crystal , Ascorbic acid , ... crystallized ascorbic acid vitamin c and sucrose photomicrography competition nikon s small world nikon s small world home photo competition video competition galleries exhibit tour news contact search enter the competitions follow small world on facebook on twitter follow nikonsmallworld annual winners photomicrography competition winners judges of prev previous next next tweet honorable mention photomicrography competition dr dennis d kunkel dennis kunkel microscopy inc kailua hawaii usa subject matter crystallized ascorbic acid vitamin c and sucrose see crystal ascorbic acid vitamin x technique polarized light see polarized light nikon instruments inc privacy terms of use nikon instruments inc...
http://nikonsmallworld.com/galleries/entry/2005-photomicrography-competition/26
*  KEGG T01814: APA12 11170
Starch and sucrose metabolism. apg00520. Amino sugar and ... 00500 Starch and sucrose metabolism APA12_11170 00520 Amino...
http://genome.jp/dbget-bin/www_bget?apg:APA12_11170
*  KEGG T00486: A1S 0062
Starch and sucrose metabolism. acb00520. Amino sugar and ... 00500 Starch and sucrose metabolism A1S_0062 00520 Amino sugar...
http://genome.jp/dbget-bin/www_bget?acb:A1S_0062
*  The Facts About Olestra ~ Center for Science in the Public Interest
substitute called sucrose polyester. Procter Gamble named its ... the facts about olestra center for science in the public interest in procter gamble researchers f mattson and r volpenhein in their quest to create a way of increasing premature babies intake of fat synthesized a fat substitute called sucrose polyester procter gamble named its product olestra the latest information the basics cspi warns consumers about frito lay light chips with olestra october popcorn makers considering using olestra may fda caves in on olestra august olestra linked to gastrointestinal disease july new olestra complaints bring total close to more than all other food additive complaints in history combined april health canada rejects olestra as a food additive june fda review of unpublished procter gamble fecal parameters study printable version acrobat k fake fat olestra sickens thousands cases makes olestra most complained about additive ever december...
http://cspinet.org/olestra/
*  Berry | Propel Fitness Water | BevNET.com Product Review + Ordering | BevNET.com
too-sweet blend of sucrose syrup and sucralose, as well as citric ... Propel Fitness Water. BevNET.com Product Review + Ordering. BevNET.com. News. Supplier News. Food News Project NOSH. Craft Beer News Brewbound. Submit News. Reviews. Submit Product For Review. BevNET Live Winter 2015. Project NOSH LA 11/5/15. Jobs. Beverage School Magazine Directories. Natural Beverage Guide. Craft Spirits Mixers Guide. Functional Beverage Guide. New Beverage Guide. Reviews. Propel Fitness Water Berry Next Product. Berry Propel Fitness Water. 23.7 fl oz PET 700 ml Nutritional Info Serving size: 8 fl oz 240 ml ; Servings per container: About 3; Amount per serving: Calories: 10; Total fat: 0g; Total carbohydrates: 3g; Sugars: 2g; Protein: 0g; Vitamin C: 10%; Vitamin E: 10%; Niacin: 25%; Vitamin B6: 25%; Vitamin B12: 4%; Pantothenic acid: 25% Ingredients Water, sucrose syrup, citric acid, natural flavors, sodium citrate, potassium citrate, sucralose, vitamin C, vitamin E acetate, niacinamide, calcium disodium EDTA, calcium pa...
http://bevnet.com/reviews/propel_fitness_water/Berry
*  Aspartame in conjunction with carbohydrate reduces insulin levels during endurance exercise.
maltodextrin and 5% sucrose C ; 2 0.04% aspartame with 2% ... maltodextrin and 5% sucrose CA ; 3 water W ; and 4 aspartame 0.04% ... Therefore, the aim of this preliminary study was to profile the insulin and blood glucose responses in healthy individuals after aspartame and carbohydrate ingestion during rest and exercise. FINDINGS: Each participant completed four trials under the same conditions 45 min rest + 60 min self-paced intense exercise differing only in their fluid intake: 1 carbohydrate 2% maltodextrin and 5% sucrose C ; 2 0.04% aspartame with 2% maltodextrin and 5% sucrose CA ; 3 water W ; and 4 aspartame 0.04% aspartame with 2% maltodextrin A. Therefore, the aim of this preliminary study was to profile the insulin and blood glucose responses in healthy individuals after aspartame and carbohydrate ingestion during rest and exercise. Results Pre-exercise There was a significant interaction effect for blood glucose p 0.001, where both the C 5.7 ± 0.7 mmol·L -1 and CA 5.7 ± 0.4 mmol·L -1 trials resu...
http://biomedsearch.com/nih/Aspartame-in-conjunction-with-carbohydrate/22853297.html
*  Clinique Liquid Facial Soap - Mild reviews, photos, ingredients page 11 - Makeupalley
glucose dioleate, sucrose, sodium hyaluronate, cetyl ... Clinique Liquid Facial Soap - Mild reviews, photos, ingredients page 11 - Makeupalley. Clinique Liquid Facial Soap - Mild. 3.5 501 reviews 58% would repurchase Package Quality: 4.2 Price: $$$ 70118 4 020714006501 020714007980 020714008000 020714227661 020714240158 020714397777 020714665128 046551804018 640034179992 666674860199 707002015192 777779598648 780231392913 885892039976 885892163091 Clinique Liquid Facial Soap - Mild Liquid Facial Soap - Mild 1 1. Age : 18 Under Skin : Dry, Tan, Warm Hair : Black, Relaxed, Medium Eyes : Brown. Age : 19-24 Skin : Very Oily, Other, Not Sure Hair : Brown, Other, Other Eyes : Brown. I will repurchase this when I run out of cleansers : Ingredients: Water purified, sodium laureth sulfate, sodium chloride, cocamidopropyl hydroxysultaine, lauramidopropyl betaine, sodium cocoyl sarcosinate, TEA-cocoyl glutamate, di-PPG-2 myreth-10 adipate, aloe barbadensis leaf juice, PEG-120 methyl glucose dioleate, sucrose, sodium hy...
http://makeupalley.com/product/showreview.asp/page=11/pagesize=15/ItemID=70118/
*  ARS | Publication request: EFFECT OF SUCROSE CONCENTRATION ON CARBOHYDRATE METABOLISM IN BEMISIA
Publication request: EFFECT OF SUCROSE CONCENTRATION ON CARBOHYDRATE METABOLISM IN BEMISIA ARGENTIFOLII: BIOCHEMICAL MECHANISM AND PHYSIOLOGICAL ROLE FOR TREHALULOSE SYNTHESIS IN THE SILVERLEAF WHITEFLY ARS : Research. ARS Office of International Research Programs. Title: EFFECT OF SUCROSE CONCENTRATION ON CARBOHYDRATE METABOLISM IN BEMISIA ARGENTIFOLII: BIOCHEMICAL MECHANISM AND PHYSIOLOGICAL ROLE FOR TREHALULOSE SYNTHESIS IN THE SILVERLEAF WHITEFLY Authors. Because of the high sugar content of plant sap, sugar is in excess and some must be excreted in the form of a sugary mixture called honeydew. In this study we examined the effect of sucrose concentration on its uptake and metabolism by the silverleaf whitefly. However, when sucrose was in excess, the whiteflies converted it to an unusual sugar called trehalulose. Technical Abstract: Uptake and metabolism of sucrose by silverleaf whiteflies Bemisia argentifolii was investigated on diets containing 3 to 30% sucrose. At an optimal pH of 7, the volume of liq...
http://ars.usda.gov/research/publications/publications.htm?SEQ_NO_115=73323
*  TCA precipitation from High% sucrose solutions - Protein and Proteomics - BioForum
... Google Sign in options. Remember me This is not recommended for shared computers Sign in anonymously Don't add me to the active users list Privacy Policy. Sign In. Forums. Forums. BioForum. Protocols and Techniques Forums. Protein and Proteomics. Javascript Disabled Detected You currently have javascript disabled. TCA precipitation from High% sucrose solutions Started by. 1 reply to this topic #1. member Active Members. Posted 05 May 2010 - 10:25 AM I am attempting to precipitate protein from fractions of a sucrose gradient. My technique has been: -Add TCA to 14%. Is there something I can change to increase the efficiency. My other concern is that I absolutely MUST be getting equal efficiency of precipitation at the whole range of sucrose concentrations 2.5 - 55%. Does anyone think that the high sucrose concentration would cause a problem... I HAVE noticed that BSA in particular seems to precipitate with less efficiency at higher sucrose concentrations... but some other proteins don't appear to be af...
http://protocol-online.org/forums/topic/14682-tca-precipitation-from-high-sucrose-solutions/
*  Preparation of sucrose esters by interesterification - Springer
... Search Help. Contact Us. Find out how to access preview-only content. Journal of the American Oil Chemists Society February 1970, Volume 47, Issue 2, pp 56-60 First online:. Preparation of sucrose esters by interesterification. R O Feuge. Affiliated with Southern Regional Research Laboratory. J Zeringue Jr. Affiliated with Southern Regional Research Laboratory. J Weiss. Affiliated with Southern Regional Research Laboratory., Mona Brown. Affiliated with Southern Regional Research Laboratory. The solvent-free interesterification of molten sucrose and fatty acid esters at temperatures between 170–187 C has now been performed with the aid of lithium, sodium and potassium soaps as catalysts and solubilizers. No sucrose esters were obtained with lithium palmitate, while the yield with lithium oleate was among the best, but consisted of over 90% tetra- and higher esters of sucrose. Lower esters were best produced with combinations of lithium oleate with sodium or potassium oleate employed at a level of about 25...
http://link.springer.com/article/10.1007/BF02541458?LI=true
*  The Blood Sugar Solution 10-Day Detox Diet - Hachette Book Group
... The Blood Sugar Solution 10-Day Detox Diet Activate Your Body's Natural Ability to Burn Fat and Lose Weight Fast By Mark Hyman MD Hardcover Book, 2014. Hyman's revolutionary weight-loss program, based on the #1 New York Times bestseller The Blood Sugar Solution, supercharged for immediate results. Hyman's groundbreaking Blood Sugar Solution program, THE BLOOD SUGAR SOLUTION 10-DAY DETOX DIET presents strategies for reducing insulin levels and producing fast and sustained weight loss. Format: Hardcover Book Price: $30.00 US/$33.00 CAN ISBN-13: 9780316240000 On Sale Date: 02/25/2014 Publisher: Little, Brown and Company Imprint: Little, Brown and Company Full Details. Formats Available: Hardcover Book, Trade Paperback, Electronic Book, Audiobook, Audiobook, Hardcover Book. Hyman's groundbreaking Blood Sugar Solution program, THE BLOOD SUGAR SOLUTION 10-DAY DETOX DIET presents strategies for reducing insulin levels and producing fast and sustained weight loss. He is the #1 New York Times bestselling auth...
http://hachettebookgroup.com/titles/mark-hyman-md/the-blood-sugar-solution-10-day-detox-diet/9780316240000/
*  "Effect of Sucrose Esters and Sunflower Oil Addition on Microstructure " by Silvana Martini, M. C.
"Effect of Sucrose Esters and Sunflower Oil Addition on Microstructure " by Silvana Martini, M. C Puppo et al. Search. Browse Collections. My Account. Digital Commons Network™. Skip to main content. USU Home A-Z Index. DigitalCommons@USU. Contact Us. Author Gallery. Academic Disciplines. Agriculture and Applied Sciences. Nutrition, Dietetics, and Food Sciences. NFS_FACPUB. NFS Faculty Publications. Title. Effect of Sucrose Esters and Sunflower Oil Addition on Microstructure of a High-Melting Milk Fat Fractions. Authors. Silvana Martini , Utah State University Follow M. C Puppo R. W Hartel M. L Herrera. Document Type. Journal/Book Title/Conference. Journal of Food Science. The effects of sunflower oil SFO and the sucrose esters SE P-1670, P-170, and S-170 on crystalline microstructure of a high-melting milk fat fraction HMF was studied by polarized-light microscopy PLM and confocal laser scanning microsopy CLSM. The addition of SFO markedly diminished crystal size and delayed crystallization kinetics, as obser...
http://digitalcommons.usu.edu/nfs_facpub/491/
*  A Comparison of the Water Potential of Potato and Sweet Potato Tubers :: Biology Lab Report
* Overall I believe that sweet potato will have a heavier end mass then that of normal potato because the normal potato will have a higher water potential and therefore lose mass when in solutions of a high sucrose concentration. Sweet Potato Table of Results 1 Start mass g end mass g Change in mass g Change of mass in % 1 molar sucrose solution 1.53 1.49 -0.04 -2.61 0.75 molar sucrose solution 1.91 1.90 -0.01 -0.52 0.5 molar sucrose solution 1.77 1.99 +0.22 +11.11 0.25 molar sucrose solution 1.82 2.17 +0.35 +16.13 Distilled water solution 1.70 2.18 +0.48 +22.02 Potato Table of Results 1 Start mass g end mass g Change in mass g Change of mass in % 1 molar sucrose solution 2.81 1.99 -0.82 -29.29 0.75 molar sucrose solution 3.22 2.50 -0.72 -22.47 0.5 molar sucrose solution 3.29 2.78 -0.51 -15.50 0.25 molar sucrose solution 3.18 3.39 +0.21 +6.60 Distilled water solution 2.78 3.05 +0.27 +9.71 Sweet Potato Table of Results 2 Start mass g End mass g Change in mass g Change of mass in % 1 molar sucrose solution 1.02...
http://123helpme.com/view.asp?id=148775
*  The Effect Of Concentration Gradient On Osmosis Biology Essay
I expect that when there is a high concentration of sucrose the water molecules from inside the potato section will go away from the potato and set off into the sucrose. In addition, as the quantity of sucrose in the solution increases the potato piece will get smaller more and as the quantity of distilled water increases in the solution, the potato piece will become turgid. The potato core to be entirely covered in the sucrose solution is too another very important part in order to make the experiment as fair as achievable. Because if the potato core is not entirely covered by the sucrose solution, the outcome of osmosis will not take place to its fullest and I would obtain dissimilar readings of the mass for each potato core, which will also make the test unreasonable. For that reason, I will use 10cm of every concentration of solution for each potatoes core. E.g., one potato core can be placed in a test tube of 10ml of 0.50M of sugar solution and one potato core can be put in a test tube of 25ml of 0.50M o...
http://ukessays.com/essays/biology/the-effect-of-concentration-gradient-on-osmosis-biology-essay.php
*  Sucrose gap
The 'sucrose gap' technique is used to create a conduction block in nerve or muscle fibers. Double Sucrose Gap Technique. The method was used to study action potentials in nerve fibers. Alix who introduced an improved chamber for the double sucrose gap with voltage clamp technique which eliminated external resistance from the node. This chamber contains an isotonic sucrose solution of a high specific resistance. Specific resistance describes the ability of a material or solution to oppose electric current, so a sucrose solution of a high specific resistance is effective in electrically isolating the three chambers. Single Sucrose Gap Technique. It is useful in the study of small nerve fibers and electrically connected cells such as smooth muscle cell. The method creates conduction block in a nerve or muscle fiber by introducing a gap of high resistance between two groups of cells. Double Sucrose Gap Technique. Two chambers containing sucrose solutions are used to isolate a node of the nerve or tissue, which i...
https://en.wikipedia.org/wiki/Sucrose_gap
*  Oral Sucrose Associated With Decreased Discomfort During Newborn Screening | Largo Medical Center |
Oral Sucrose Associated With Decreased Discomfort During Newborn Screening. Largo Medical Center. Largo, FL. Patients & Visitors. Patients & Visitors Patients & Visitors. H2U - health to you. Patient Portal. Pay Bill Online. Health Info. Health Info Health Info. Health Library. Video Library. Careers. For Medical Staff. Hospital Affiliation Letters for Medical Center Staff. Hospital Information. Hospital Leadership. Patients & Visitors. Patients & Visitors Classes Events. H2U - health to you. News World Report - Best Hospital Edition Quality standards and exclusive rankings earn Largo Medical Center a spot in the 2015 Best Hospital edition of U.S. Largo Medical Center @LargoMedical RT @tobaccofreefla: Smoking damages nearly every organ in the body. Oral Sucrose Associated With Decreased Discomfort During Newborn Screening. 2 milliliters of 24% sucrose solution, administered by mouth using a syringe over 1 to 2 minutes 1 gram of liposomal lidocaine 4% cream to the dorsum of the hand Both sucrose and lidocaine ...
http://largomedical.com/hl/?/2011196941/Oral-Sucrose-Associated-With-Decreased-Discomfort-During-Newborn-Screening
*  Diabetics – Blood Sugar Solution | Mark's Daily Apple Health and Fitness Forum page
Diabetics – Blood Sugar Solution. Mark's Daily Apple Health and Fitness Forum page. New Posts. Today's Posts. Diabetics – Blood Sugar Solution. Thread: Diabetics – Blood Sugar Solution page. TorMag Senior Member. Join Date Jan 2011 Location Johns Creek, GA Posts 559. Diabetics – Blood Sugar Solution. All, I have been Primal now for almost 1 year, Sept 5 will be my Primal Birthday, as of today I have dropped 94 lbs. I am a Type two diabetic. Unlike a lot of Type II’s who have gone Primal, I have not been “Cured” of my diabetes, in fact, I have gotten worse. After reading Mark’s book, I decided to take myself off of insulin, staying on the oral medications that I was taking. I mentioned going back on insulin two weeks ago on another thread when someone mentioned to me to check out the Blood Sugar Solution book by Dr. Hyman. Hyman has a six week plan to “cure” you of Type II diabetes. Hyman’s Solution is basically Whole 30 with a bunch of supplements. I Kettlebell therefore I am. My Journal My Journal. Reply Wit...
http://marksdailyapple.com/forum/thread65127.html
*  How many grams of sucrose (C12H22O11) must be dissolved
How many grams of sucrose C12H22O11 must be dissolved. Tuesday October 6, 2015 School Subjects Art. Business. Computers. English. Foreign Languages. Health. Home Economics. Math. Music. Physical Education. Science. Social Studies. Grade Levels Preschool. Kindergarten. Elementary School. 1st Grade. 2nd Grade. 3rd Grade. 4th Grade. 5th Grade. 6th Grade. 7th Grade. 8th Grade. High School. 9th Grade. 10th Grade. 11th Grade. 12th Grade. College. Adult Education. Post a New Question. Current Questions. Homework Help : chemistry Posted by cheri on Sunday, September 16, 2012 at 10:40pm. How many grams of sucrose C12H22O11 must be dissolved in 200 g water to make a solution in which the mole fraction of su- crose is 0.1. Answer in units of g chemistry - DrBob222, Sunday, September 16, 2012 at 10:59pm 200 g H2O is how many mols. That's g/molar mass. total mol = n sucrose + n H2O n sucrose = grams/molar mass sucrose. = 0.1 Substitute grams/molar mass for n sucrose and solve for grams. chemistry - cheri, Sunday, Septembe...
http://jiskha.com/display.cgi?id=1347849636
*  Sucrose synthase
... image sucrose synthase s png in enzymology a sucrose synthase is an enzyme that catalyzes the chemical reaction ndp glucose d fructose rightleftharpoons ndp sucrose thus the two substrates of this enzyme are ndp glucose and d fructose whereas its two products are ndp and sucrose this enzyme belongs to the family of glycosyltransferase s specifically the hexosyltransferases the systematic name of this enzyme class is ndp glucose d fructose alpha d glucosyltransferase other names in common use include udpglucose fructose glucosyltransferase sucrose synthetase sucrose udp glucosyltransferase sucrose uridine diphosphate glucosyltransferase and uridine diphosphoglucose fructose glucosyltransferase this enzyme participates in starch and sucrose metabolism references category ec...
https://en.wikipedia.org/wiki/Sucrose_synthase
*  Sucrose intolerance
... Name = Sucrose intolerance. ICD10 =. ICD9 = {{ICD9|271.3}}. ICDO =. eMedicineSubj =. MeshID = }} 'Sucrose intolerance', also called 'congenital sucrase-isomaltase deficiency' CSID. or 'sucrase-isomaltase deficiency',. 2 is the condition in which sucrase, an enzyme needed for proper metabolism of sucrose sugar, is not produced in the small intestine. It is common among the Inupiat people. 3 Overview Signs and Symptoms of Sucrose Intolerance See also References External links. Overview. Sucrose also known as 'saccharose' is a disaccharide and is a two-sugar chain composed of glucose and fructose which are bonded together. In most cases, sucrose intolerance is an autosomal recessive, genetic, metabolic disease, and involves deficiency in the enzyme sucrase, which breaks apart the glucose and fructose molecules. Monosaccharides, or single sugar units, are absorbed directly into the blood. When disaccharides are consumed, they must be broken down into monosaccharides by enzymes in the intestines before they c...
https://en.wikipedia.org/wiki/Sucrose_intolerance
*  hfcs vs liquid sucrose vs invert liquid sucrose
... Forum. Mark Forums Read. Forum. hfcs vs liquid sucrose vs invert liquid sucrose. Thread: hfcs vs liquid sucrose vs invert liquid sucrose. 01-26-2009, 04:19 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. hfcs vs liquid sucrose vs invert liquid sucrose O.K. www.raineshoneyfarm.com. Reply With Quote. 01-26-2009, 08:54 PM. Ian. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,391. Ian Steppler Canadian Beekeeper's Blog www.stepplerfarms.com. Reply With Quote. 01-26-2009, 11:43 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. Reply With Quote. Ian. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,391. Ian Steppler Canadian Beekeeper's Blog www.stepplerfarms.com. Reply With Quote. jean-marc. View Profile. View Forum Posts. Private Message....
http://beesource.com/forums/showthread.php?225395-hfcs-vs-liquid-sucrose-vs-invert-liquid-sucrose&p=388551
*  hfcs vs liquid sucrose vs invert liquid sucrose
... Forum. Mark Forums Read. Forum. hfcs vs liquid sucrose vs invert liquid sucrose. Thread: hfcs vs liquid sucrose vs invert liquid sucrose. 01-26-2009, 04:19 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. hfcs vs liquid sucrose vs invert liquid sucrose O.K. www.raineshoneyfarm.com. Reply With Quote. 01-26-2009, 08:54 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,390. Ian Steppler Canadian Beekeeper's Blog www.stepplerfarms.com. Reply With Quote. 01-26-2009, 11:43 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. Reply With Quote. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,390. Ian Steppler Canadian Beekeeper's Blog www.stepplerfarms.com. Reply With Quote. jean-marc. View Profile. View Forum Posts. Private Message. Join Date...
http://beesource.com/forums/showthread.php?225395-hfcs-vs-liquid-sucrose-vs-invert-liquid-sucrose&p=389536
*  ARS | Publication request: Rapid colorimetric microplate assay for determining glucose and sucrose c
ARS. Publication request: Rapid colorimetric microplate assay for determining glucose and sucrose content in potato tubers ARS : Research. ARS Home. About ARS. International Programs. Find an office at headquarters. Site Map. Related Topics Programs and Projects. ARS National Programs. ARS Office of International Research Programs. ARS Office of International Research Programs Regional Contacts. Title: Rapid colorimetric microplate assay for determining glucose and sucrose content in potato tubers Authors. Submitted to: Potato Association of America Proceedings Publication Type: Abstract Only Publication Acceptance Date: July 27, 2007 Publication Date: August 12, 2007 Citation: Bethke, P.C., Busse, J.S. Rapid colorimetric microplate assay for determining glucose and sucrose content in potato tubers. Potato Association of America Proceedings 91st meeting. Technical Abstract: Accurate quantification of tuber glucose and sucrose content is important for scientific as well as commercial purposes. High pressure li...
http://ars.usda.gov/research/publications/publications.htm?SEQ_NO_115=212669
*  Sucrose 6F-alpha-galactosyltransferase
sucrose f alpha galactosyltransferase sucrose f alpha galactosyltransferase in enzymology a sucrose f alpha galactosyltransferase is an enzyme that catalyzes the chemical reaction udp galactose sucrose rightleftharpoons udp f alpha d galactosylsucrose thus the two substrates of this enzyme are udp galactose and sucrose whereas its two products are udp and f alpha d galactosylsucrose this enzyme belongs to the family of glycosyltransferase s specifically the hexosyltransferases the systematic name of this enzyme class is udp galactose sucrose f alpha d galactosyltransferase other names in common use include uridine diphosphogalactose sucrose f alpha galactosyltransferase udpgalactose sucrose fru alpha galactosyltransferase and sucrose f alpha galactotransferase references category ec category enzymes of unknown structure...
https://en.wikipedia.org/wiki/Sucrose_6F-alpha-galactosyltransferase
*  Prenulin lowers circulating glucose and insulin levels after acute oral sucrose challenge. - Nu
... traIngredients-USA.com. This might limit your experience on this website. SUBSCRIBE. FREE NEWSLETTER. Breaking News on Supplements & Nutrition - North America EU edition. Manufacturers. Research. Markets. Regulation. People. Site Archive. Product claims. Omega-3. Health. Blood sugar management. Bone & joint health. Cancer risk reduction. Cardiovascular health. Eye health. Gut/digestive health. Healthy aging. Maternal & infant health. Men's health. Oral/gum health. Respiratory health. Skin health. Sports nutrition. Weight management. Women's health. Resources. All Products. Product Brochures. Ingredients. Antioxidants/carotenoids. Botanicals & Herbals. Dairy-based ingredients. Dosage forms & delivery formats. Fibers & carbohydrates. Minerals. Nutricosmetics. Omega-3s & Nutritional oils. Probiotics & prebiotics. Proteins, peptides, amino acids. Soy-based ingredients. Vitamins & premixes. Resources. All Products. Supplier Webinars. Videos Audio. Technical Papers. Product Brochures. Suppliers. Events. Food Jo...
http://nutraingredients-usa.com/Ingredients/Minerals/Prenulin-lowers-circulating-glucose-and-insulin-levels-after-acute-oral-sucrose-challenge
*  Effects of Sucrose on the Extracellular Matrix of Plaque-Like Biofilm Formed in vivo, Studied by Pro
In the ECM of PLB formed under sucrose exposure, the following changes compared with the control PLB were observed: 1 the presence of upregulated proteins that may be involved in bacterial response to environmental changes induced by sucrose and 2 the absence of calcium-binding proteins that may partly explain the low inorganic concentration found in ECM of PLB formed under sucrose exposure. Therefore, the absence of calcium-binding proteins in the ECM of PLB formed under exposure to sucrose ta- Table 2. Thus, the presence of calcium-binding pro- teins, exclusively in ECM of the PLB formed in the ab- sence of sucrose, supports the view that these proteins, in addition to plaque Ca binding, may act as organic mineral reservoirs in PLB....
http://researchgate.net/publication/23297398_Effects_of_Sucrose_on_the_Extracellular_Matrix_of_Plaque-Like_Biofilm_Formed_in_vivo_Studied_by_Proteomic_Analysis
*  Sucrose octaacetate
... chembox watchedfields changed verifiedrevid imagefile sucrose octaacetate png imagesize iupacname acetic acid s s r r acetoxy bis acetoxymethyl r r s r r triacetoxy acetoxymethyl tetrahydropyranyl oxy tetrahydrofuranyl ester othernames section chembox identifiers casno ref casno pubchem smiles cc o oc o o o coc o c oc o c oc o c coc o c oc o c oc o c oc o c section chembox properties formula c h o molarmass g mol appearance needles density g cm at c meltingptc boilingptc boilingpt notes at mmhg solubility slightly soluble in water solubleother soluble in ethanol diethyl ether acetone benzene chloroform section chembox hazards mainhazards flashpt autoignitionpt sucrose octaacetate is an acetylated derivative of sucrose it is used commercially and industrially in a variety of applications it is used as an inert ingredient in pesticide s and herbicide s as of december sucrose octaacetate was determined by the epa to be usable as an inert ingredient in pesticides due to its low toxicity sucrose octaacetate h...
https://en.wikipedia.org/wiki/Sucrose_octaacetate
*  BISC110: Series 4 Lab 11 Enzymology - OpenWetWare
When yeast cells are grown in YEP+2% glucose, the transcription of genes for enzymes that are needed to break down sugars other than glucose is repressed, so those enzymes are not produced within the cell. Using this assay you will determine the amount of invertase produced by normal, "wild type" yeast grown in YEP+2% glucose normal glucose medium and in YEP+0.05% glucose minimal glucose medium. However, the mutants should grow almost as well as the wild type cells on YEP+2% glucose. Based on genetic regulation of invertase production by glucose repression, form a hypothesis about the relative amounts of invertase that the wild type and mutant strains of yeast will make when grown in media containing 2% glucose or in 0.05% glucose. You will use DNS reagent to assay the activity of both purified invertase and any invertase that has been produced by the two yeast strains grown in either 2% or 0.05% glucose. To test the purified invertase indirectly, you will add some to a solution of sucrose, allow time for the...
http://openwetware.org/wiki/BISC110:_Series_4_Lab_11_Enzymology
*  [IAEP] Sucrose 0.83.6 in Soas
sucrose in soas sucrose in soas simon schampijer simon at schampijer de tue feb est previous message sucrose in soas next message mediawiki messages sorted by tomeu vizoso wrote on tue feb at simon schampijer simon at schampijer de wrote hi sucrose the release candidate has find it s way into sugar on a stick get the latest image at http download sugarlabs org soas snapshots soas iso does it work in xos regards tomeu no we have a kernel issue bernie has pinged the right people that needs to be fixed first to be able to build xo images cheers simon previous message sucrose in soas next message mediawiki messages sorted by more information about the iaep mailing list...
http://lists.sugarlabs.org/archive/iaep/2009-February/004185.html
*  Exercise 6.9 - Chemical Composition of Myelin
... LEVEL III. Materials. Calf brain 10 0.25 M sucrose 0.88 M sucrose Blender or tissue homogenizer Refrigerated centrifuge. Procedure. Homogenize 100 gms of calf brain in 0.25 M sucrose to make a 10% brei. Centrifuge the homogenate at 500 xg for 10 minutes at 4° C. Collect the supernatant and recentrifuge the supernatant at 11,000 xg for 10 minutes. 11. Discard the supernatant and resuspend the pellet in 10 ml. of 0.25 M sucrose. Carefully add 25 ml of 0.88 M sucrose to the bottom of the tube, so that the resuspended pellet lies on top of the sucrose. Centrifuge at 11,000 xg for 10 minutes to separate the mitochondria from the myelin vessicles. The myelin will float on the surface, while the denser mitochondria should pellet at the bottom of the tube. Carefully remove the upper myelin vessicle layer. Return to Table of Contents. Cell Biology Laboratory Manual. Dr. William H. Heidcamp, Biology Department, Gustavus Adolphus College, St. Peter, MN 56082 -- cellab@gac.edu....
http://homepages.gac.edu/~cellab/chpts/chpt6/ex6-9.html
*  KEGG T01064: Dsec GM20028
Pentose and glucuronate interconversions. Ascorbate and aldarate metabolism. Starch and sucrose metabolism. Porphyrin and chlorophyll metabolism. Drug metabolism - other enzymes. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00040 Pentose and glucuronate interconversions Dsec GM20028 00053 Ascorbate and aldarate metabolism Dsec GM20028 00500 Starch and sucrose metabolism Dsec GM20028 Metabolism of cofactors and vitamins 00830 Retinol metabolism Dsec GM20028 00860 Porphyrin and chlorophyll metabolism Dsec GM20028 Xenobiotics biodegradation and metabolism 00980 Metabolism of xenobiotics by cytochrome P450 Dsec GM20028 00982 Drug metabolism - cytochrome P450 Dsec GM20028 00983 Drug metabolism - other enzymes Dsec GM20028 Enzymes 2. AA seq 397 aa. +upstream nt +downstream nt atgtatctactcttaaatggcctggatgtgatggtcacttcacaggctgatctgctaaag gatccgagattccaacgcgttttccagaccaaattcgatttgatgatattgggctcgttt ttcaacgactttaaattgggagttgctggcaagctgaaggtacccgtaatagtcgactgg atgatgctgtcgaacaccatgatcgatgagtttgtggccaatccct...
http://genome.jp/dbget-bin/www_bget?dse:Dsec_GM20028
*  KEGG T00582: RBAM 025880
Bacillus methylotrophicus FZB42: RBAM_025880. Entry RBAM_025880 CDS T00582. Gene name ysdC. Definition RefSeq hypothetical protein. KO K01179. endoglucanase. Organism bay Bacillus methylotrophicus FZB42. Pathway bay00500. Starch and sucrose metabolism. bay01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism RBAM_025880 ysdC Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds 3.2.1.4 cellulase RBAM_025880 ysdC. Position complement 2713678..2714763. AA seq 361 aa. NT seq 1086 nt. +upstream nt +downstream nt atgacaaaattagatgaaacgctcaccatgctgaaagcgttaacggatgcaaaagggata ccgggaaatgagagagaagtaagacaagtgatgaaatcatacatagaaccatttgccgat gatgtcacaacagaccggctgggaagcttaatcgccaaaaaaacgggcaaagaaaacggt ccgaaaatcatgatctcagggcatttagatgaagtcggttttatggtgacgcaaatcact gataaaggctttctccgctttcaaaccgtcggcggctggtggtctcaggtcatgctggcc cagcgcgtcaccgtcgtgacaaaaaaaggggacatcacggggatcatcggttcgaaaccg cctcacattctgcct...
http://genome.jp/dbget-bin/www_bget?bay:RBAM_025880
*  KEGG T01388: Tmar 1690
Thermaerobacter marianensis: Tmar 1690. Entry Tmar 1690 CDS T01388. Definition RefSeq peptidase M42 family protein EC:3.2.1.4. endoglucanase. Organism tmr Thermaerobacter marianensis. Pathway tmr00500. Starch and sucrose metabolism. tmr01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Tmar 1690 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds 3.2.1.4 cellulase Tmar 1690. Position complement 2028917..2030074. AA seq 385 aa. NT seq 1158 nt. +upstream nt +downstream nt atggcgaccccagctgagcaggccggagggcagcccggcgtcccggccggtggacaggcc ggcggcgagtcacgtctgatcggtttcctccgcgacctgacccagacctacggcccctcg ggccgggaagacgcggtgcgcgagtacatccgcgcccggatcgaaccgtgggcggacgaa gtgcgcgtcgacgccctgggcaacttgatcgcccggcgcgcgccgcgggggaccggggcg gatgcggccggtcccggcacccctgcagccgccgggtccgcaggaggtgccgaggggcct gggggccgcggggccggccggcgcatcatgatcgctgcccatatggacgagatcgccgtc atcgccacccacatcgacgacaagggcttcatccgcgtggagcccgtgg...
http://genome.jp/dbget-bin/www_bget?tmr:Tmar_1690
*  KEGG T01403: Psesu 1585
... Pseudoxanthomonas suwonensis: Psesu 1585. Entry Psesu 1585 CDS T01403. Definition RefSeq glycoside hydrolase family protein. KO K01179. endoglucanase. Organism psu Pseudoxanthomonas suwonensis. Pathway psu00500. Starch and sucrose metabolism. psu01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Psesu 1585 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds 3.2.1.4 cellulase Psesu 1585. SSDB. Motif Pfam: Cellulase. Other DBs NCBI-ProteinID: ADV27430 NCBI-GI: 319787186 NCBI-GeneID: 10123157 JGI: Psesu 1585 UniProt: E6WTD1. Position complement 1750757..1751776. AA seq 339 aa. MSRTTLLAGLCLGLMALLPNAMAADPRPLSAADQVARMGAGVNVLGYDPYWKAGEQGNYR EEHFAKIREAGFGTVRVALFTFPHLDEANRLDPQWLAKLDQVIGWGTGNGLQVILDVHDF NDCVKDVPACEVKLEQVWTQLGERYAGQPDQVVFELLNEPHGALDAKAWNGLFAKLLEVV RRTNPTRNVVVGPTRWNNLEELDTLQLPEDDRHLIVTFHYYEPFAFTHQGASWVEPQFSE KTGVRFNTPGQVAKIESDFDKVKAWSRKHDRPILLGEYGAYDKAPMEDRVYWTRTVARAA...
http://genome.jp/dbget-bin/www_bget?psu:Psesu_1585
*  KEGG T01603: Halar 2192
... Halophilic archaeon: Halar 2192. Entry Halar 2192 CDS T01603. Definition GenBank Cellulase EC:3.2.1.4. KO K01179. endoglucanase. Organism hah Halophilic archaeon. Pathway hah00500. Starch and sucrose metabolism. hah01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Halar 2192 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds 3.2.1.4 cellulase Halar 2192. SSDB. Motif Pfam: Peptidase M42. Other DBs NCBI-ProteinID: AEN05873 JGI: Halar 2192 UniProt: G2MM46. Position complement 1431209..1432276. AA seq 355 aa. MQTPQREFLDALLTTPSPSGFETRGQRVWVDYVSQFADRVETDAYGNAVAIHEGDPDEDT EFAVGGHADEIGFIVRDITDEGFLRIARVGGSDRTVSKGQHVTVHTDEGPVQGVIGQTAI HLREQGKEEYEEIAEQFVDIGATDDEDAKELVTIGDPATFSSGIQELKGSRVAARGMDNR TGTWVAAETLRRASEAGAAATVVAVSTVQEEVGLKGAQMVGYDLDPDAFIAVDVTHATDN PDVAGKNRGPVKLSEGPVVGRGSANHPALVDLAREAADADDVDHQFQAAGSGTGTDADGV FTERGGIPSLNVSIPNRYMHTPVEVVDLEDLDAVADLCVGMAERAAEDAPFGVDI. NT seq 106...
http://genome.jp/dbget-bin/www_bget?hah:Halar_2192
*  KEGG T00914: Kole 0040
... Kosmotoga olearia: Kole 0040. Entry Kole 0040 CDS T00914. Definition RefSeq peptidase M42 family protein. KO K01179. endoglucanase. Organism kol Kosmotoga olearia. Pathway kol00500. Starch and sucrose metabolism. kol01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Kole 0040 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds 3.2.1.4 cellulase Kole 0040. SSDB. Motif Pfam: Peptidase M42 Peptidase M20 Peptidase M28 Peptidase M18. Other DBs NCBI-ProteinID: ACR78769 NCBI-GI: 239616451 NCBI-GeneID: 7968865 JGI: Kole 0040 UniProt: C5CHD0. Position complement 46655..47677. AA seq 340 aa. MKTPELLIKLSNAFGPVGYEDEVRKIIQEEIEPYVDEVKVDNLGNLIAFKRGTGKKKVAF FAHIDEVSLVVSAKDERGFLRFDTMGGIDPKVLIAQRVKVVSKDGKVRRGVIGVLAPHLQ KAADRKNIPPMDEMFIDVSMNPDYEKIEIGDLVVIDTEAFESNGKVIGKALDDRACAVIS ILVAKQLSKFSRFPDVYFVFTSREEVGGMGARVAAEAIQPDVGIAMDVTHAHKRTGIELG KGPAITVGGPNIHKGYFKMLDDVAKREGVKVQYEIAAGRTGTDADNVQIAGT...
http://genome.jp/dbget-bin/www_bget?kol:Kole_0040
*  KEGG T02381: Deipe 3548
Entry Deipe 3548 CDS T02381. Organism dpd Deinococcus peraridilitoris. Starch and sucrose metabolism. dpd01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Deipe 3548 Enzymes 2. AA seq 500 aa. NT seq 1503 nt. +upstream nt +downstream nt atgacgcggtccagtggcgttctgctgcacctgacttcgctgcccggaccgtacggcata ggagaattcaatgagcacgcatatgcctgcgtcgactggcttgctcgggccggacagcag tactggcaggtgatgccgcttggcccgaccggctacggcgacagcccctatcagtcattc agtgcgtttgccggcaatccatacctgatttcactggacgccctgcggcgcgacggcctg ctgagcgatcaggatctgtccggtcatccagacttcgaccacgaccgtgttgatttcggc gtgcagtacacgtggcgcaatggggtgttgcgccgcgccttcgagcacttcgaggcgggc gctggcgcggggttgacgggcgacttccaggccttttgcgaagccgaggccgcctggctc gacgattacgcgttgttcatggccctcaaggatgcgcatggtggacgggcctggaatgaa tgggaccgcgagatccgcacccggcaaagtgcggcaatggccgcgtggcgcgacaagctg gagcgcgaggtgcggctgtacagctttgtgcagtttctgtttttccgtcagtggaacgca ctgcgcgcttacgcccaccagcagggcgtgcagatcatcggcgacattccgatttttgtg gcgatggattcggcggacgcgtgggccaaccccgaccagttttat...
http://genome.jp/dbget-bin/www_bget?dpd:Deipe_3548
*  KEGG T01867: Ththe16 1275
Organism tts Thermus thermophilus SG0.5JP17-16. Starch and sucrose metabolism. tts01100. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Ththe16 1275 Enzymes 2. Position complement 1226750..1228252. AA seq 500 aa. NT seq 1503 nt. +upstream nt +downstream nt atggagcttccccgcgctttcggcctgcttctccaccccacgagcctccccggcccctac ggcgtcggcgtcctgggccaggaggcccgggacttcctccgcttcctcaaggaggcgggg gggcggtactggcaggtcctccccttgggccccacgggctatggcgactccccctaccag tccttcagcgccttcgccggaaacccctacctcatagacctgaggcccctcgcggagcgg ggctacctgcgcctggaggaccccggcttcccccaaggccgggtggactacggcctcctt tacgcctggaagtggcccgccctgaaggaggccttccggggcttcaaggaaaaggcctcc ccggaggagcgggaggccttcgccgccttccgggagagggaggcctggtggctcgaggac tacgccctcttcatggccctgaaggcccaccacggggggcttccctggaaccggtggccc ctttccctgcggaagcgggaagagaaggcccttagggaggcgaaaagcgccttggccgag gaggtggccttccacgccttcacccagtggctcttcttccgccagtggggggccttgaag gcggaggccgaggcgttgggcatccggatcatcggggacatgcccatcttcgtggccgag gactccgccgaggtctgggcccaccccgagtggtttcacctggacgag...
http://genome.jp/dbget-bin/www_bget?tts:Ththe16_1275
*  KEGG T01128: Sthe 1074
Entry Sthe 1074 CDS T01128. Organism sti Sphaerobacter thermophilus. Pathway sti00500. Starch and sucrose metabolism. sti01100. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Sthe 1074 Enzymes 2. AA seq 502 aa. NT seq 1509 nt. +upstream nt +downstream nt gtggtagtgtctggcaggacggcagggatccttcttcacccgacgtcgctcccggggcca catggggtcggggatcttggcgggtcggcggcgcggttcatcgactggctcagcgaggca aggcaaggtctgtggcagatcctgccgctggggcctcccggcgccggggactcgccgtac gacgcgcggtcgtcgtttgcgggcaacccgctgctgatcgcattgtccccgctggtcgag tggggtctgcttaccgccgacgaggtgccgccaccgctgatgtccgacccggagcgtgcc gacttcgccggggcgaccagcgtcaagctgaccgcccttgcgcgggcattcgagcgcttt gaggcaagcggcgatggcgagttgcgcgttgcctatgaggagttctgggagcgggagagg gcctggctggccgattacgcgctctatgctgcgctgcgcacggcgcacgacggcctgccc tggtaccgctgggagccgggcctcgttcggcgcgagcccgcagcacttgccgagtggcgg gcgcggttggaccgtgaggtccgctttcacgccttcctccagttcgtcttcgatcgccag tggaccactctgaagcactacgccaacgagcggggcatccgtatcgtgggggacatcccg atctacgtctcccacgacagtgccgacgtatgggcgcaccaggacctctt...
http://genome.jp/dbget-bin/www_bget?sti:Sthe_1074
*  KEGG T01496: SELMODRAFT 123852
Definition RefSeq hypothetical protein. Starch and sucrose metabolism. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism SELMODRAFT 123852 Enzymes 2. AA seq 540 aa. NT seq 1623 nt. +upstream nt +downstream nt atggtttccagtgctctatcgccgggggatgatttgccagacgagtatgagaaggatgat ccttcaaagaaggccatgcccagaagagctgggattattttgcatcctacttctttgcct ggaccgcatgggattggagaccttggtccagacgcttttagatttctcgattggctcgag tctactggatgtcgcatttggcaggttctgccattggtacctcctgggagaaaagccgga gaggatggatcgccttacgctggacaagatgctaactgcgggaatactcttctgatctcg ctgactgaactcgtcaaagatggtcttctggaagaagaagatattcctgaggctatacct gtcgagaaaattaactatgaagctgtagccgagctcaaggatccattgattcaaaaggct gcaaagaatttggtgcaaaatggaggttctttgaagaaggatctcgaaaattttcgaaag agcccccaaattgcaagctggctggaagaagctgctttatttgcagctatagattcacat ttcgatgacggagcctggtggcaatggccagagcctctgcgagatagaaatccttcggca ctagataaagctcggaaagagcataaagactttattgacgtttttattgcgcaacaattt ttgtttcaaaagcagtggcaagctttgcatacgtacgcaaatgaaagaggaatcaagatt attggcgacatgccgatttacgtaggaggtcatagtgc...
http://genome.jp/dbget-bin/www_bget?smo:SELMODRAFT_123852
*  [Histonet] Sucrose and paraffin
sucrose and paraffin sucrose and paraffin from molinari betsy hi all i have no experience with ihc but once again had a researcher ask me if placing tissue in sucrose after nbf is helpful in antigen staining thanks betsy betsy molinari ht ascp texas heart institute cardiovascular pathology bertner ave houston tx fax histonet mailing list histonet lists utsouthwestern edu http lists utsouthwestern edu mailman listinfo histonet previous message next message...
http://histosearch.com/histonet/Oct07/HistonetSucroseandparaffi.html
*  Sucrose diacetate hexaisobutyrate
... redirect sucrose acetate isobutyrate...
https://en.wikipedia.org/wiki/Sucrose_diacetate_hexaisobutyrate
*  Sucrose
... redirect saccharose...
https://fr.wikipedia.org/wiki/Sucrose
*  File:Sucrose b.gif
file sucrose b gif file sucrose b gif summary not copyrighted no image in the world looks like this delete if it is found elsewhere licensing...
https://en.wikipedia.org/wiki/File:Sucrose_b.gif
*  Sucrose
... redirect sacarose...
https://pt.wikipedia.org/wiki/Sucrose
*  [mythtv-users] No Livetv on frontend without backend
2007-04-23 16:16:22.306 MainServer::HandleAnnounce Monitor 2007-04-23 16:16:22.334 adding: sucrose as a client events: 0 2007-04-23 16:16:22.337 MainServer::HandleAnnounce Monitor 2007-04-23 16:16:22.338 adding: sucrose as a client events: 1 2007-04-23 16:16:22.340 Reloading backend settings 2007-04-23 16:16:22.344 Received a remote 'Clear Cache' request 2007-04-23 16:19:54.836 MainServer::HandleAnnounce Monitor 2007-04-23 16:19:54.865 adding: sucrose as a client events: 0 2007-04-23 16:19:54.875 MainServer::HandleAnnounce Monitor 2007-04-23 16:19:54.893 adding: sucrose as a client events: 1 2007-04-23 16:19:54.920 MainServer::HandleAnnounce Playback 2007-04-23 16:19:54.922 adding: sucrose as a client events: 0 2007-04-23 16:19:55.035 TVRec 16 : Changing from None to WatchingLiveTV 2007-04-23 16:19:55.045 TVRec 16 : HW Tuner: 16- 16 2007-04-23 16:19:57.981 Finished recording Who Wants to Be a Millionaire: channel 4081 2007-04-23 16:19:58.084 scheduler: Finished recording: Who Wants to Be a Millionaire: channe...
http://lists.mythtv.org/pipermail/mythtv-users/2007-April/178072.html
*  KEGG T03070: CQ11 10440
Starch and sucrose metabolism. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds 3.2.1.1 alpha-amylase CQ11 10440 5. AA seq 572 aa. +upstream nt +downstream nt gtgactccatcgaacttcgacacacacttcccaggtatctccgaagatccgaactggttc aaaactgccgttttctatgaggtgctcttgcgcgccttcggagattccactgggacgggc ctaggtgacctgcgcggccttatcggccacctagattacctccagtggctcggcgtcgat tgcctgtggatcccgcctttctacccctcccccatgcgcgacggcggttacgacgtctcg aatttcaccgcgatttcacccgaatacggcacgattgaggagttcggcgagctcatcgag caggctcaccggcgtggcatccgcatcatcatcgacctcgtgatcaaccacacctctgac cagcacccgtggttccagtcgtcgcgttctaacccggacggccccttcggagacttctac gtgtggcgcgacgacgacgccgagtacgccgatgcccgcatcatcttcatcgacaccgag gccagcaactggacgttcgatccggtgcgccgccaatacttctggcatcgcttcttctct caccagccggatctcaactatgaaaacccgaaggtgcgcgaggcgatcaaggacgtggtg cgcttttgggccaaactcggaatcgacggcttccgcctcgacgccgtgccctatctgttc gaggaagagggcacgaactgcgaaaatctgcctcgcacccacgcctacctggcagagctg cgcgcgatgttggacgccgaattcccaggcaagatcctgcttgccgaggcgaatcagtgg ccgaacgacgtcgtgga...
http://genome.jp/dbget-bin/www_bget?tpy:CQ11_10440
*  EC 2.4.1.13
ec ec redirect sucrose synthase...
https://en.wikipedia.org/wiki/EC_2.4.1.13
*  Granulated sugar
... redirect sucrose white refined...
https://en.wikipedia.org/wiki/Granulated_sugar
*  Caster sugar
... redirect sucrose caster...
https://en.wikipedia.org/wiki/Caster_sugar
*  EC 3.1.3.24
ec ec redirect sucrose phosphatase...
https://en.wikipedia.org/wiki/EC_3.1.3.24
*  Saccharobiose
... redirect sucrose...
https://en.wikipedia.org/wiki/Saccharobiose
*  My low carb low sugar diet
... Register. Sign In. Search in:. Foods. Recipes. Meals. Challenges. Exercises. Members. Journals. Groups. Forums. Diets. Tips. My FatSecret. Foods. Recipes. Challenges. Fitness. Diets Community. Diets. Member Diets. My low carb low sugar diet. My low carb low sugar diet. Summary:. This is a low carb, low sugar diet, high vegetables. Suited for diabetics, or prediabetics. la karla's food tips. Foods you can have. Breads, Grains, Cereals, Pasta, Rice. Meat and Fish. Fruit and Fruit Juices. Vegetables and Legumes e.g. Dairy Products - Milk, Cheese, etc. Fats and Oils. Herbs, Spices, Sauces. Recent Activity for My low carb low sugar diet. View: all activity. journals. calendar. kitchen. tips. How To Follow My low carb low sugar diet:. The point is to change eating habits and acquire new healthier ones. Every week try to make a different change in habits and to meditate on the need to make the change. by member la karla. Hello all, my name is Karla, i am 35 this year, i am having a very hard time losing weight....
http://fatsecret.com/diets/member-diet/Default.aspx?dietid=216073
*  No Flour No Sugar Diet Food List
... Home Contact Us Sitemap. Weight Loss Diets Vegetarian Diets Diets For Blood Type Medical Diets. Breaking News. Ischemic Colitis Diet Plan The Best Practice. Catt Sadler Diet More Think About Eat. Acxion Diet Pills Questions And Answers. ABS Diet Food List. What is the Cenegenics Diet meal program. Home. Weight Loss Diets. No Flour No Sugar Diet Food List. No Flour No Sugar Diet Food List. People compassionate non-engaged nutritionist has to admit that a diet with such seemingly simple and obvious to any fool slogan in the title no flour no sugar diet food list a highly wise way to lose weight. Sedentary person yes, there is such evolutionary branch of Homo Sapiens, not to engage in strenuous physical work or exercise, for healthy nutrition, provide energy and necessary substance, not need any sweetener or white flour products. These are the carbohydrates from which sedentary people get grow fat. Also, many people have allergic to gluten, which is why they should avoid white bread, biscuits, pasta and lik...
http://top-diet.com/no-flour-no-sugar-diet-food-list
*  Mylene Perreault - ResearchGate
... Mylene Perreault. Are you Mylene Perreault. Article:. Cynthia Rohde Mylene Perreault. Ruth E. DOI:10.4161/mabs.23826 4.56 Impact Factor. Article:. Mice Deleted for GPAT3 Have Reduced GPAT Activity in White Adipose Tissue and Altered Energy and Cholesterol Homeostasis in Diet-induced Obesity. Ronald W Clark Mylene Perreault. James F Tobin. Ruth E Gimeno. However, when fed a high-fat diet, female Gpat3 -/- mice showed decreased body weight gain and adiposity and increased energy expenditure. Article:. Ruth E Gimeno. In vivo, peripheral administration of TAM-163 decreased food intake and/or body weight in mice, rats, hamsters, and dogs, but increased food intake and body weight in monkeys. DOI:10.1371/journal.pone.0062616 3.23 Impact Factor. Article:. Cynthia Rohde Mylene Perreault. Ruth E Gimeno. 4.56 Impact Factor Source Available from: Xin Xu. Article:. When orally dosed in C57/BL6 diet-induced obesity DIO mice, HSD-621 was efficacious and showed a significant reduction in both fed and fasting glucose an...
http://researchgate.net/researcher/39043697_Mylene_Perreault
*  The Nutrispec Letter 03-00
"THE DEADLY QUARTET." This is the name given by physiologists to the metabolic syndrome which includes: - obesity - elevated triglycerides - elevated blood pressure - diabetes The name derives from the fact that if you have these four conditions simultaneously you don't have much life to look forward to. Every one of your patients who shows a ketogenic tendency is a prime candidate for adult onset diabetes, plus, elevated blood pressure, elevated triglycerides and cardiovascular disease. Physiologists determined decades ago that insulin resistance was associated with high blood pressure, obesity, diabetes and elevated triglycerides. Did you have to be already obese before a high fat plus high sugar diet would cause insulin resistance. Here is the sequence: Step One - High Fat + High Sugar Diet. Step Two - Insulin Resistance - Decreased Glucose Transport - Elevated Serum Insulin Step Three - Elevated Serum Triglycerides - Increased Size of Abdominal Fat Cells Step Four - Elevated Blood Pressure - Increased Clo...
http://royalrife.com/0300.html
*  Diabetic fruit flies support buzz about dietary sugar dangers | Science Codex
Diabetic fruit flies support buzz about dietary sugar dangers. Science Codex. RSS Feeds » Sitewide. Earth. Heavens. Body. Brain. Culture. Technology. Home Earth Heavens Body Brain Culture Tech. Diabetic fruit flies support buzz about dietary sugar dangers Posted By News On January 17, 2013 - 5:31am. Tweet. LA JOLLA, Calif., January 15, 2013 – Regularly consuming sucrose—the type of sugar found in many sweetened beverages—increases a person's risk of heart disease. In a study published January 10 in the journal PLOS Genetics, researchers at Sanford-Burnham Medical Research Institute and Mount Sinai School of Medicine used fruit flies, a well-established model for human health and disease, to determine exactly how sucrose affects heart function. In addition, the researchers discovered that blocking this cellular mechanism prevents sucrose-related heart problems. "Our study reveals a number of specific sugar-processing enzymes that could be targeted with therapies aimed at reducing sucrose's unhealthy effects on...
http://sciencecodex.com/diabetic_fruit_flies_support_buzz_about_dietary_sugar_dangers-105234
*  Sugar Diet Chat In Urdu | SitaGita.com
Sugar Diet Chat In Urdu. SitaGita.com. Scroll Log In. Register. SG Live. Follow. SG Live Recipes. Personalities Videos. Slideshows. Home. Fashion. Relationships. Parenting. Health. Lifestyle. Entertainment. Career. Shopping. Blogs. Polls. Forum. Groups. SG Live. Sugar diet chat in urdu:Forum Section. Diet chart for Sugar patients. by deepika755. 05 Apr, 2013. 1 replies. 1953 views. Please help me with some easy to follow diet chart for sugar patients Read More... Diet chart for Sugar patients. by megha433. 05 Apr, 2013. 1 replies. 1953 views. In India nearly 4.5 million people are suffering from diabetes. The meal of a diabetic patient depends on its age, gender, weight and working etc. Therefore different dietary charts are created for different persons. Below is given an easy to follow diet chart for a general diabetic patient. Morning At 6 am: fenugreek powder tea... Read More... Dry fruits name in Urdu. by pinky117. 09 May, 2013. 2 replies. 1444 views. I have never ever able to remember the name of dry fr...
http://sitagita.com/story/sugar-diet-chat-in-urdu/
*  :: Best Way To Beat Sugar Addiction : The 21 Day Sugar Detox Manual From Balanced Bites | Help Break
:: Best Way To Beat Sugar Addiction : The 21 Day Sugar Detox Manual From Balanced Bites. Help Break Your Addiction To Sugar 24. Help Break Your Addiction To Sugar 24. Tuesday, December 4, 2012. :: Best Way To Beat Sugar Addiction : The 21 Day Sugar Detox Manual From Balanced Bites. Best Way To Beat Sugar Addiction This Is An Easy-to-follow Three Week Program To Help Break Your Addiction To Sugar And Carbs. Includes Over 90-pages In The Program Guide, Supplement Guide, & Faqs Guide. Great For Low-carb, Primal Or Paleo Diets Or Simply The Transition. Best Way To Beat Sugar Addiction Do Omni Detox Drinks Work How Long Does Alcohol Detox Take At Home Is Cranberry Juice Good For A Detox Yogurt For Detox Sugar Addiction Glutamine Candida Sugar Addiction Long Term Effects Of Sugar Addiction Detox Apple Cinnamon Water Recipe Look Out For Detox A Low Sugar Diet What Is A Healing Crisis Detox Reaction What Is The 21 Day Detox After Reiki Detox For Sugar Addiction Sugar Addiction Help Uk How Good Are Detox Diets Sugar D...
http://helpbreakyouraddictiontosugar24.blogspot.com/2012/12/best-way-to-beat-sugar-addiction-21-day.html
*  :: Drinking Distilled Water For Detox : The 21 Day Sugar Detox Manual From Balanced Bites | Help Bre
:: Drinking Distilled Water For Detox : The 21 Day Sugar Detox Manual From Balanced Bites. Help Break Your Addiction To Sugar 19. Help Break Your Addiction To Sugar 19. :: Drinking Distilled Water For Detox : The 21 Day Sugar Detox Manual From Balanced Bites. Drinking Distilled Water For Detox This Is An Easy-to-follow Three Week Program To Help Break Your Addiction To Sugar And Carbs. Includes Over 90-pages In The Program Guide, Supplement Guide, & Faqs Guide. Great For Low-carb, Primal Or Paleo Diets Or Simply The Transition. Drinking Distilled Water For Detox Do Omni Detox Drinks Work How Long Does Alcohol Detox Take At Home Is Cranberry Juice Good For A Detox Yogurt For Detox Sugar Addiction Glutamine Candida Sugar Addiction Long Term Effects Of Sugar Addiction Detox Apple Cinnamon Water Recipe Look Out For Detox A Low Sugar Diet What Is A Healing Crisis Detox Reaction What Is The 21 Day Detox After Reiki Detox For Sugar Addiction Sugar Addiction Help Uk How Good Are Detox Diets Sugar Diet Acne What Is Ni...
http://helpbreakyouraddictiontosugar19.blogspot.com/2013/01/drinking-distilled-water-for-detox-21.html
*  :: Does A Detox Make You Tired : The 21 Day Sugar Detox Manual From Balanced Bites | Help Break Your
:: Does A Detox Make You Tired : The 21 Day Sugar Detox Manual From Balanced Bites. Help Break Your Addiction To Sugar 19. Help Break Your Addiction To Sugar 19. Friday, August 17, 2012. :: Does A Detox Make You Tired : The 21 Day Sugar Detox Manual From Balanced Bites. Does A Detox Make You Tired This Is An Easy-to-follow Three Week Program To Help Break Your Addiction To Sugar And Carbs. Includes Over 90-pages In The Program Guide, Supplement Guide, & Faqs Guide. Great For Low-carb, Primal Or Paleo Diets Or Simply The Transition. Does A Detox Make You Tired Do Omni Detox Drinks Work How Long Does Alcohol Detox Take At Home Is Cranberry Juice Good For A Detox Yogurt For Detox Sugar Addiction Glutamine Candida Sugar Addiction Long Term Effects Of Sugar Addiction Detox Apple Cinnamon Water Recipe Look Out For Detox A Low Sugar Diet What Is A Healing Crisis Detox Reaction What Is The 21 Day Detox After Reiki Detox For Sugar Addiction Sugar Addiction Help Uk How Good Are Detox Diets Sugar Diet Acne What Is Nina ...
http://helpbreakyouraddictiontosugar19.blogspot.com/2012/08/does-detox-make-you-tired-21-day-sugar.html
*  No sugar for a year produces sweet results
... Sign in with Facebook Sign in with Google Sign In FAQ. Sign in with Facebook Sign in with Google Sign in FAQ. Facebook Email. No sugar for a year produces sweet results. There are plenty of reasons for American families to put the brakes on sugar consumption. Type 2 diabetes, heart disease, and other obesity-related medical conditions have all been linked to a diet overloaded with the sweet stuff. No sugar for a year produces sweet results There are plenty of reasons for American families to put the brakes on sugar consumption. Type 2 diabetes, heart disease, and other obesity-related medical conditions have all been linked to a diet overloaded with the sweet stuff. This story is part of Health and Wellness. Communities try to make a difference through collaboration on health. Houston tries to slim down with food, fitness. No sugar for a year produces sweet results. Greta Schaub, 13, takes a bite out of vegetable pizza made with no-sugar tomato sauce during her family's year of no added su...
http://ksdk.com/story/news/nation/2014/04/13/hidden-sugar-book/7247561/
*  On density of DNA
... michael cooley szcooley at bullwinkle ucdavis edu mon dec est previous message on density of dna next message on density of dna messages sorted by antonio rodriguez franco bb rofra at lucano wrote i assume ethidium bromide increases the density of dna is that is true does anybody know what the density of dna should be in the presence and in the absence of etbr antonio r franco cordoba spain no etbr decreases the density of dna that is why the chromosomal dna will band above the plasmid band in equilibrium centrifugation the chromosomal dna binds more etbr due to it linear form dr michael cooley practice random kindness mbcooley at ucdavis edu and senseless acts of beauty previous message on density of dna next message on density of dna messages sorted by more information about the methods mailing list...
http://bio.net/bionet/mm/methods/1994-December/021770.html
*  S9 fraction
s fraction s fraction the s fraction is the product of an organ tissue homogenate used in biological assay s the s fraction is most frequently used in assays that measure the metabolism of drugs and other xenobiotic s it is defined by the u s national library of medicine s iupac glossary of terms used in toxicology as the supernatant fraction obtained from an organ usually liver homogenate by centrifuging at g for minutes in a suitable medium this fraction contains cytosol and microsomes the microsomes component of the s fraction contain cytochrome p isoforms phase i metabolism and other enzyme activities the cytosolic portion contains the major part of the activities of transferase s phase ii metabolism the s fraction is easier to prepare than purified microsomes applications references further reading external links applications the s fraction has been used in conjunction with the ames test to assess the mutagenic potential of chemical compounds chemical substances sometimes require metabolic activation in ...
https://en.wikipedia.org/wiki/S9_fraction
*  Buoyant density ultracentrifugation
... buoyant density centrifugation uses the concept of buoyancy to separate molecules in solution usually a caesium chloride cscl solution is used but in the general case it s usually approximately the same density as the molecules that are to be centrifuge d the sample is put on top of the solution and then the tube is spun at a very high speed for an extended time at times lasting days the cscl molecules become densely packed toward the bottom so even layers of different densities form since the original solution was approximately the same density they go to a level where their density and the cscl density are the same to which they form a sharp distinctive band this method very sharply separates molecules and is so sharp that it can even separate different molecular isotopes from one another references category separation processes...
https://en.wikipedia.org/wiki/Buoyant_density_ultracentrifugation
*  Biology-Online • View topic - Identify the nucleic acid!
Biology-Online View topic - Identify the nucleic acid. Biology-Online. Identify the nucleic acid. Identify the nucleic acid. Sat Feb 16, 2008 5:15 am A nucleic acid sample is resistant to digestion with lambda exonuclease.When heated it does not show typical melting curve of a linear double stranded DNA.On CsCl-ethidium bromide equilibrium density centrifugation it settles at the bottom of the centrifuge tube.The nucleic acid is: a/ccc pBR322 b/ Bacteriophage P22 DNA c/rRNA d/RF II M13 DNA VaIbHaV tYaGi where ways seem to be converging call the almighty. Re: Identify the nucleic acid. Re: Identify the nucleic acid. The insensitivity to it almost automatically rules out all the other choices because they are all ds DNAs: pBR322 is a standard plasmid; Phage P22 DNA is ds; M13 RF DNA RF stands for “replicative” form, though I’m not quite sure what the II is for is a ds circle, although the infective DNA is ss and would be resistant to lambda exonuclease. rRNA should be resistant to the exonuclease, does not have...
http://biology-online.org/biology-forum/about13070.html?p=96679&hilit=Lambda bacteriophage
*  Items where Author is "Nöthig, Eva-Maria" - ePIC
... Browse. Author. Year. Platform. Organizations. Programs. Research Networks. Type. Search. Simple. Advanced. About. About. Policies. Citation Guide. Login. Alfred-Wegener-Institut Helmholtz-Zentrum für Polar- und Meeresforschung. Imprint. Contact. OAI. RSS 2.0. EPIC.awi.de. Home. Browse. Author. Year. Platform. Organizations. Programs. Research Networks. Type. Search. Simple. Advanced. About. About. Policies. Citation Guide. Login Login. Items where Author is " Nöthig, Eva-Maria ". Up a level. Export as ASCII Citation BibTeX DocExport Dublin Core EP3 XML EndNote EndNote HTML Citation. RSS 2.0. Group by: Item Type. No Grouping Jump to: Article. Inbook. Thesis. Conference. "Berichte zur Polar- und Meeresforschung". PANGAEA Documentation. Number of items: 147. Article Article Busch, K., Bauerfeind, E. and Nöthig, E. M 2015 Pteropod sedimentation patterns in different water depths observed with moored sediment traps over a 4-year period at the LTER station HAUSGARTEN in eastern Fram Strait, Polar Bi...
http://epic.awi.de/view/creators/N=F6thig=3AEva-Maria=3A=3A.html
*  Patent US4354901 - Flexible absorbent boards - Google Patents
3 TABLE IV EFFECT OF DENSITY ON GURLEY STIFFNESS CARBOXYMETHYL CELLULOSE HydrocolloidPressure Concentration psi % by Weight: 20% 40% 60% 80% 90% 0 Gurley gm 33.6 30.0 29.1 30.8 34.2 Density g/cc 0.21 0.21 0.22 0.27 0.29 % Increase 0 0 0 0 035.7 Gurley gm 13.0 11.9 14.2 23.4 22.7 Density g/cc 0.32 0.33 0.32 0.31 0.34 % Increase 47.6 57.1 45.5 14.8 17.2107.14 Gurley gm 9.9 11.0 11.2 18.2 16.4 Density g/cc 0.42 0.41 0.36 0.38 0.41 % Increase 100.0 95.2 63.6 40.7 41.4178.5 Gurley gm 8.1 8.5 7.3 11.7 13.0 Density g/cc 0.50 0.47 0.48 0.44 0.45 % Increase 138.1 123.8 118.2 63.0 55.2249.9 Gurley gm 6.3 6.8 7.9 8.7 16.2 Density g/cc 0.54 0.51 0.52 0.50 0.53 % Increase 157.1 142.8 136.4 85.2 82.8357.0 Gurley gm 5.9 6.3 6.9 8.9 9.7 Density g/cc 0.62 0.61 0.61 0.54 0.55 % Increase 195.2 100.5 177.3 100.0 89.7535.5 Gurley gm 6.6 6.2 5.9 6.1 6.3 Density g/cc 0.70 0.67 0.68 0.61 0.64 % Increase 233.3 219.1 209.1 125.9 120 ...
http://google.com.au/patents/US4354901
*  MayoClinic.com Health Library - Artificial sweeteners and other sugar substitutes
... Riverside Regional Medical Center Riverside Walter Reed Hospital Riverside Tappahannock Hospital Riverside Shore Memorial Hospital Riverside Doctors' Hospital Specialty Hospitals. Artificial sweeteners and other sugar substitutes. Artificial sweeteners and other sugar substitutes. If you're trying to reduce the sugar and calories in your diet, you may be turning to artificial sweeteners or other sugar substitutes. Artificial sweeteners Sugar alcohols Novel sweeteners Natural sweeteners. Unlike sugar, artificial sweeteners generally don't raise blood sugar levels because they are not carbohydrates. But because of concerns about how sugar substitutes are labeled and categorized, always check with your doctor or dietitian about using any sugar substitutes if you have diabetes. Sugar alcohols aren't considered noncaloric or non-nutritive sweeteners because they contain calories. Sugar alcohols are considered nutritive sweeteners because they contribute calories to your diet. This means that sugar alcohols ca...
http://riversideonline.com/health_reference/Articles/MY00073.cfm
*  Calories in Artificial Sweeteners | Nutrition Facts - Page 3
Calories in Artificial Sweeteners. Calories in Artificial Sweeteners Foods. Sugars and Syrups. Sugars and Sweeteners. Sugar-Free Candy. Springfield Low Calorie Sweetener Whey Low Sweetener - Granular Whey Low Sugar - for Diabetics SweetLeaf Sweetener - SteviaTabs IGA Sweetener Smart Sense Sweetener - Aspartame Smart Sense Sweetener - Sucralose Ideal Low Calorie Sweetener - Confectionary O Organics Agave Sweetener - Organic, Light O Organics Agave Sweetener - Raw, Organic Good Delish Sweetener - with Saccharin Good Delish Sweetener - with Sucralose Rite Aid Sugar Substitute - 1/4 Grain, Tablets Batey Sweetener - Stevia, Natural Batey Sweetener - Stevia Turbinado Sugar, Natural, Light Raley's Fine Foods Sweetener - Granulated Raley's Fine Foods Sweetener - Natural Spartan Sweetener - Calorie-Free, Packets Spartan Sweetener - No Calorie, Packets Necta Sweet Sugar Substitute - Saccharin, Tablets Clear Value Sweetener - with Calcium Saccharin America's Choice Sugar Substitute - with Sucralose America's Choice Suga...
http://caloriecount.com/calories-artificial-sweeteners-ic1972-2
*  Pros, cons of artificial sweeteners | Home - Home
Back To Mobile Site Back To Mobile Site. If you're trying to reduce the sugar and calories in your diet, you may be turning to artificial sweeteners or other sugar substitutes. Understanding artificial sweeteners and other sugar substitutes Sugar substitutes are loosely considered any sweetener that you use instead of regular table sugar sucrose. Artificial sweeteners Sugar alcohols Novel sweeteners Natural sweeteners. Artificial sweeteners Artificial sweeteners are synthetic sugar substitutes but may be derived from naturally occurring substances, including herbs or sugar itself. Unlike sugar, artificial sweeteners generally don't raise blood sugar levels because they are not carbohydrates. But because of concerns about how sugar substitutes are labeled and categorized, always check with your doctor or dietitian about using any sugar substitutes if you have diabetes. These GRAS substances, including highly refined stevia preparations, are deemed by qualified professionals based on scientific data as being sa...
http://krcrtv.com/pros-cons-of-artificial-sweeteners/27409190
*  Lentis/High-Fructose Corn Syrup - Wikibooks, open books for an open world
High fructose corn syrup tanker. High-Fructose Corn Syrup HFCS is a sweetener used as a substitute for sugar in food products. This chapter will explore the social interface of technology with respect to High-Fructose Corn Syrup HFCS in the United States. High-Fructose Corn Syrup Edit. High-Fructose Corn Syrup is a food sweetener that functions as a low-cost alternative to table sugar. Origins of High-Fructose Corn Syrup Edit. Factors that Affect the Social Construction of High-Fructose Corn Syrup Edit. Non-Natural Edit. To address this, the Corn Refiners Association proposed changing the name of HFCS to "corn sugar". Corn Refiners Association Edit. In 2008, based on survey results they concluded that “myths associated with high fructose corn syrup have led many consumers to believe it is different from table sugar”. The following links are three commercials that the Corn Refiners Association released as part of their "Changing the Conversation about HFCS" campaign. A few of the important individuals and grou...
https://en.m.wikibooks.org/wiki/Lentis/High-Fructose_Corn_Syrup
*  Don't Sugar-Coat High-Fructose Corn Syrup - The Atlantic
Don't Sugar-Coat High-Fructose Corn Syrup - The Atlantic. Don't Sugar-Coat High-Fructose Corn Syrup. Health Don't Sugar-Coat High-Fructose Corn Syrup The history of corporate marketing efforts and the obesity epidemic make the corn-syrup name change a crime. Advocates have long pointed out that high-fructose corn syrup is far from natural. The Corn Refiners Association name change is another attempt to present high-fructose corn syrup as natural similar to and not any more harmful than table sugar. Says the trade association's website SweetSurprise.com, "High fructose corn syrup is made from corn a natural grain product. High fructose corn syrup contains no artificial or synthetic ingredients or color additives and meets the Food and Drug Administration's FDA requirements for use of the term 'natural.'" But advocates have long pointed out that high-fructose corn syrup is far from natural. Look, no matter what high-fructose corn syrup is called, it is added sugar, empty calories, and not good for us. ...
http://theatlantic.com/health/archive/2010/09/dont-sugar-coat-high-fructose-corn-syrup/63195/
*  Artificial sweetener - Simple English Wikipedia, the free encyclopedia
... Artificial sweetener. From Wikipedia, the free encyclopedia. An artificial sweetener or sugar substitute is a chemical. It is added to some foods to make them taste sweet. Usually it has a much lower energy value than sugar. It can be found in many products which say Light or Diet in their name. Consumers use artificial sweeteners for one of the following reasons:. Diabetes mellitus - People with diabetes have problems regulating their sugar levels in the blood. Artificial sweeteners are better for them than sugar. Reactive hypoglycemia - This is a condition similar to diabetes. People who suffer from it therefore often use artificial sweeteners Some people think that artificial sweeteners can help them lose weight. A study at the university showed, however, that those people using artificially sweetened drink are more likely to become obese than those who do not. Studies done with animals have shown that artificial sweeteners cause weight gain. A sweet taste causes insulin to be produced. This will stor...
https://simple.wikipedia.org/wiki/Artificial_sweetener
*  The Pros and Cons of Artificial Sweeteners
... December 24, 2010. Sugar is only about 11 calories. In realizing that a substitute had to be in place, artificial sweeteners the word artificial here is very annoying came into being which are mostly are basically zero calories, and yet again there was controversy especially over the artificial sweetener known as aspartame. The controversy that surrounds this whole artificial sweetener controversy just beats me and only goes to show that people will believe anything these days. But for those who want to know more about artificial sweeteners, let s look at the choices and what makes it so controversial. Artificial Sweeteners. And yes, all sweeteners are zero calories as opposed to the 11 calories for sugar which pales in comparison to the large number of calories that we rack, thanks to packaged foods that have gotten away with murder. However, sweeteners are divided into two types: nutritive and non-nutritive sweeteners. List of Artificial Sweeteners. So here is a list of the most popular artificial swee...
http://fitbuff.com/the-pros-and-cons-of-artificial-sweeteners/
*  Is high-fructose corn syrup bad for you? (Page 7) - EatingWell
Is high-fructose corn syrup bad for you. Page 7 - EatingWell. Mobile Site Digital Editions. Newsletters. Magazine. Hello. My Account. Logout. EatingWell Where Good Taste Meets Good Health. More Close. Advanced Recipe Search. Recipes & Menus. Recipe Collections. Browse All Recipes. Easy Recipes. Dinner Ideas. Vegetarian Recipes. Kids Recipes. Healthy Desserts. Special Diet Recipes. Menus Meal Plans. Holidays Occasions. Drink Recipes. Recipe Slideshows. Breakfast Recipes. Diet Recipes. Recipes for Two. Healthy Cooking. Healthy Cooking 101: Basics Techniques. Kids Cooking. Healthy Food Guide. Cooking for Two. Quick Healthy Cooking. Holiday Entertaining. Wine, Beer Spirits Guide. Kitchen Product Reviews. About Our Test Kitchen. Recipe Makeovers. Budget Cooking. Diet & Health. Make Healthy Happen. Weight-Loss Diet Plans. Blood Pressure. Bone Health. Cholesterol. Diabetes. Digestive Health. Gluten-Free Diet. Healthy Aging. Healthy Kids. Healthy Pregnancy. Heart Health. Immunity. Mind, Body Spirit. Nutrient Library....
http://eatingwell.com/nutrition_health/nutrition_news_information/is_high_fructose_corn_syrup_bad_for_you?page=7&order=timestamp&sort=asc&quicktabs_1=2?page=7&order=timestamp&sort=asc&quicktabs_1=2
*  Facts about sweeteners and sugar substitutes.
... Comprehensive Information about Sugar and Sweeteners of all Types. My purpose with this website is to present you with all the facts about sweeteners and sugar substitutes. So enjoy your food. . Do you know what happens to your body when you consume excessive amounts, particularly if taken over a short period of time and without exercise?  Do you know the difference between the various types of sweeteners that are commonly added to the food you eat?  Have you heard of high fructose corn syrup, and do you really know what it is and why it is used in your drinks and food?  Do you know the early symptoms of type 2 diabetes, what commonly causes it, and the affect it can have on a persons life expectancy, and quality of life?  Even if the answer to all the above is yes, you are still likely to discover new and fascinating information about sweeteners that you were unaware of.  A huge amount of sweeteners now exist, and are added to everything, from pizza, to chewing gum and toot...
http://sugar-and-sweetener-guide.com/
*  How Artificial Sweeteners Work - HowStuffWorks
... How Stuff Works Science. Follow us. Adventure Animals Auto Culture Entertainment Health Home Garden Lifestyle Money Science Tech Video Shows Quizzes. How Artificial Sweeteners Work by Lee Ann Obringer. Browse the article How Artificial Sweeteners Work. Introduction to How Artificial Sweeteners Work. If you're trying to lose weight, avoiding sugar is one of the best ways to reduce your calorie intake. Many dieters use artificial sweeteners and artificially sweetened foods as a way to cut sugar without eliminating all things sweet. However, not all artificial sweeteners are calorie free. In fact, some have almost as many calories as sugar. They're also somewhat controversial. Although the manufacturers' Web sites and the Food and Drug Administration FDA say that artificial­ sweeteners are perfectly safe, some consumer groups and physicians disagree. Even if you try to avoid artificial sweeteners, you may still be consuming them in products you've never considered. Did you know that artificial sweeteners ar...
http://science.howstuffworks.com/innovation/edible-innovations/artificial-sweetener8.htm/printable
*  Study supports low-calorie sweeteners as way to help prevent, manage diabetes - Drug Store News
... Pharmacy news and CE. DSN DrugStoreNews.  Latest News opener. Retail. Products. Top Retailers opener. Kroger. Pharmacy opener. Insights opener. Special Reports. Promo Watch. Subscribe. Advertise. Show Watch. Store Tours. AmerisourceBergen ThoughtSpot  Subscribe. Advertise. Study supports low-calorie sweeteners as way to help prevent, manage diabetes. ATLANTA Low-calorie sweeteners can be used to prevent and manage Type 2 diabetes, according to a new study. Endocrinology, examined the role between excess weight gain and management and prevention of Type 2 diabetes from available literature. The study found that replacing added sugars with low-calorie sweeteners can reduce the rise in blood-glucose levels and aid in controlling weight and that the sweeteners don't affect weight gain because they have no adverse effects on insulin and hormone levels. Foods and beverages sweetened with low-calorie sweeteners offer lower-calorie alternatives that can be important tools in the fight against obesity and diabe...
http://drugstorenews.com/article/study-supports-low-calorie-sweeteners-way-help-prevent-manage-diabetes
*  Calories in Pectin, Unsweetened, Dry Mix | Nutrition and Health Facts
Calories in Pectin, Unsweetened, Dry Mix. Foods. Overview Food Browser Recipe Browser New Recipe. Foods. Foods Activities Recipes Forums Groups. Overview. Food Browser. Recipe Browser. Calories in Pectin, Unsweetened, Dry Mix. Foods. Wondering how many calories are in Pectin, Unsweetened, Dry Mix. package 1.75 oz package 1.75 oz grams oz cal. Add to Log Pectin, Unsweetened, Dry Mix. Pectin, Unsweetened, Dry Mix C+ Grade 163 Calories. Nutrition Facts Serving Size 1 package 1.75 oz 50 g Per Serving % Daily Value* Calories 163 Calories from Fat 1 Total Fat 0.1 g 0 % Saturated Fat 0 g 0 % Polyunsaturated Fat 0 g Monounsaturated Fat 0 g Cholesterol 0 mg 0 % Sodium 100 mg 4 % Potassium 3.5 mg 0 % Carbohydrates 45.2 g 15 % Dietary Fiber 4.3 g 17 % Sugars 0 g Protein 0.1 g. Pectin, Unsweetened, Dry Mix Calories and Health Benefits. Fat. Get Nutritional Facts and the Health Benefits for Pectin, Unsweetened, Dry Mix. Related Foods Categories. Related Recipes Course - Dessert Main Ingredient - Fruits Main Ingredient - C...
http://caloriecount.com/calories-pectin-unsweetened-dry-mix-i19310
*  Safe Sugar Substitutes for People With Diabetes - Diabetes Center - Everyday Health
... The Diabetes Diet and Blood Sugar. Diabetes Safe Sugar Substitutes for People With Diabetes. Using artificial sweeteners is considered a safe way to help control blood sugar levels — and today, there are more choices than ever. If you have diabetes and are trying to control your weight and blood sugar levels, sugar substitutes can help satisfy your sweet tooth, without potentially harmful sugar or carbohydrates. Plus, the body does not fully absorb artificial sweeteners, so the few calories they may contain do not affect blood sugar levels. Sugar Substitutes in the Diabetes Diet. Food and Drug Administration FDA has approved six sugar substitutes for use: sucralose, saccharin, stevia, aspartame, neotame, and acesulfame potassium. Here's a look at popular sweeteners and what they mean for your diet. It’s sold under the brand name Sweet’N Low and is 200 to 700 times sweeter than sugar. Many diet colas and other diet foods contain saccharin. But the National Cancer Institute and FDA have since concluded tha...
http://everydayhealth.com/diabetes/diabetes-and-sugar-substitutes.aspx
*  The Case Against Artificial Sweeteners | Sugar Substitutes
Loading Please Wait. Mercola. Health Articles. Fructose/Sugar. Mercola. Loading Please Wait. Artificial sweeteners can actually be far worse for you than sugar and fructose, and scientific evidence backs up that conclusion. Natural sweeteners such as honey and agave may seem like a healthier choice, but not only are they loaded with fructose, many are also highly processed. In moderation, some sugar alcohols can be a better choice than highly refined sugar, fructose or artificial sweeteners. Of the various sugar alcohols, xylitol is one of the best. Three of the best sugar substitutes are all-natural Stevia from the whole plant, Lo Han Guo, and dextrose pure glucose. Loading Please Wait. Previous Article. Next Article. Previous Article. Next Article. Mercola With all the dire health effects associated with refined sugar and high fructose corn syrup HFCS, many wonder what, if anything, is actually safe to use to sweeten your foods and beverages. A previous National Geographic article 1 set out to compare eight...
http://articles.mercola.com/sites/articles/archive/2013/10/07/sugar-substitutes.aspx?e_cid=20131007Z1_DNL_art_1
*  Artificial Sweeteners: Why You Should Completely Avoid Them to Stay Healthy | Mic
Most artificial sweeteners and most foods that contain artificial sweeteners as ingredients. There are a plethora of these aritifical sweeteners, which include: acesulfame potassium also identified as acesulfame k and ACE, alitame, aspartame, aspartame-acesulfame salt, corn syrup also identified as corn sweetener and corn syrup solids, cyclamate, high fructose corn syrup also identified as: corn sugar, corn sweetener, glucose-fructose syrup, HCFS-42, HCFS-55, HCFS-90, isoglucose, hydrogenated starch hydrosylate, neohesperidine dihydrochalcone also identified as neohesperidine dc, neotame, saccharin, sucralose, and sugar alcohols which include: erythritol, glucitol/sorbitol, glycerol/glycerin, isomalt, lactitol, maltitol, mannitol, sorbitol and xylitol. Aspartame is approximately 200 times sweeter than sugar and has little to no calories. Aspartame-acesulfame salt is non-caloric and 350 times sweeter than sugar. It is composed of 64% aspartame and 36% acesulfame potassium. How to avoid corn syrup: avoid produc...
https://mic.com/articles/16014/artificial-sweeteners-why-you-should-completely-avoid-them-to-stay-healthy
*  Artificial sweeteners: Doubts by the teaspoonful - Hawaii News - Honolulu Star-Advertiser
News Breaking. Hawaii Beat. Hawaii Warrior World. Hawaii.com. Although many people have nagging worries about artificial sweeteners, they still use mountains of them globally, artificial sweeteners are a $1.5-billion-a-year market to avoid sugar and calories. A LITTLE IS A LOT Part of Williams confidence about safety is that the artificial sweeteners are much more intensely sweet than sugar, so people consume very little of them. The Center for Science in the Public Interest, a health advocacy group, slaps an avoid label on saccharin and aspartame, but deems sucralose and neotame a newer, more intense sweetener that is chemically similar to aspartame to be safe. What about the studies that suggest that artificial sweeteners, despite their dearth of calories, cause weight gain. A huge study at a cancer research institute in Italy found that rats given aspartame had higher rates of leukemia and lymphomas. The National Cancer Institute in Maryland, however, reviewed health data from a half a million retirees and...
http://staradvertiser.com/news/nyt/20120612_Artificial_sweeteners_Doubts_by_the_teaspoonful.html
*  Are Artificial Sweeteners Bad for You?
Are Artificial Sweeteners Bad for You. The Cravings Coach Diana Walker. Cravings Weightloss Healthy Lifestyles Healthy Recipes Podcast Archives Emotional Eating GMO. Are Artificial Sweeteners Bad for You. 3 Podcasts August 25, 2008 By. Diana Walker. 4 Comments ARE ARTIFICIAL SWEETENERS BAD FOR YOU. Many of you have heard me talk about the many hidden side effects and dangers of using artificial sweeteners like Aspartame, also known as Nutrasweet, and Splenda, which is also known as Sucralose. PART 1, Podcast 19, Artificial Sweeteners. PART 2, Podcast 20, Pregnancy and Artificial Sweeteners. PART 3, Podcast 21, Dangers of Aspartame Splenda Sucralose. It is important to read your labels when you are shopping, and also avoid many items, like diet yogurt, lite yogurt, anything that has the word diet or lite in it. Also avoid products that say no sugar, because no sugar chewing gum and no sugar and diet candies are also harmful and bad for you. Diana Walker, Cravings Coach. Filed Under: Cravings Weightloss, Health...
http://thecravingscoach.com/blog/are-artificial-sweeteners-bad-for-you-3-podcasts/
*  .. Sugar Substitute (Homemade Truvia®) .. Why Use Alternative Sweeteners? .. Reasons to Make You
Budget Help / Sugar Substitute Homemade Truvia®. Sugar Substitute Homemade Truvia® Posted By. I’ve been using low carb sweeteners for awhile now–ever since I found out that I had candida. I was a complete sugar addict, but really had to break the habit and start using sweeteners like stevia and other low carb sugar substitutes. I’m always trying to find ways to make a healthy diet more affordable, so I’ve developed recipes for Homemade Liquid Stevia Drops, Sugar Free Chocolate Chips,  Easiest Coconut Milk, Homemade Coconut Butter, and more. Today I am going to share with you a way to make Homemade Truvia® and do low carb baking without the high ticket price. I love natural sweeteners, but they just don’t love me. You could go out and purchase Truvia, or other sugar substitutes, but then you would be paying about $10-$16 per pound.  That’s why I use them and they also taste better. 2  Better taste.  You will find that your resulting sweet treats taste much better when using more than one kind. Sugar Su...
http://wholenewmom.com/whole-new-budget/sugar-substitute-like-truvia/
*  Mercury Found in High-Fructose Corn Syrup - NaturalNews.com
... About NaturalNews Contact Us Write for NaturalNews Media Info Advertising Info. Mercury Found in High-Fructose Corn Syrup Thursday, March 26, 2009 by: Reuben Chow Tags: mercury, health news, Natural News. Recently, two separate studies, one published in the journal Environmental Health and the other conducted by the Institute for Agriculture and Trade Policy IATP, have revealed a further danger of high-fructose corn syrup, having found that it may contain mercury. Environmental Health Study In the report of the first study, it was noted that mercury cell chlor-alkali products are used to make many food ingredients; these include citrus acid, sodium benzoate, as well as high-fructose corn syrup. IATP Study For the IATP study, the researchers had tested 55 popular brand-name food products and detected mercury in 17 of them see WebMD link below for a list of the affected products. Further, the IATP study had found mercury in food products taken off the shelves in 2008. Either way, mercury poisoning via HFCS...
http://naturalnews.com/025935.html
*  Can you Cook and Bake with Artificial Sweeteners? | Your Guide to Diet and Diabetes | U of I Extensi
Can you Cook and Bake with Artificial Sweeteners. University of Illinois Extension. Eating for Target Blood Glucose Levels. Test Your Knowledge. Can you Cook and Bake with Artificial Sweeteners. Yes, it is possible to cook and bake with artificial sweeteners, but different sweeteners have different qualities. Familiar home recipes for desserts may contain large amounts of sugar and it may be tempting to replace this sugar entirely with artificial sweeteners. It also helps make the familiar golden brown color of baked desserts and breads. Sometimes sugar is a main ingredient, as in cakes and cookies. When it is, replacing sugar entirely with artificial sweeteners may produce a product that is tough, flat, and dry, as well as gray in color. Remember that most artificial sweeteners only make a recipe sweet. Cakes, cookies, and meringues depend on large amounts of sugar for more of their finished properties. You should not replace more than two cups of sugar with an artificial sweetener in these types of products...
http://extension.illinois.edu/diabetes2/subsection.cfm?SubSectionID=34
*  Artificial Sweeteners : Artificial Sweeteners I What The Heck Are You Eating I Everyday Health
... Artificial Sweeteners. Wednesday, May 1, 2013. Artificial Sweeteners I What The Heck Are You Eating I Everyday Health. Posted by. Taylor Ulrich. at 7:57 PM. Email This. BlogThis. Share to Twitter. Share to Facebook. Share to Pinterest. No comments:. Post a Comment. Newer Post. Older Post Home. Subscribe to: Post Comments Atom. Blog Archive. 2013 19. May 18 They're Called Artificial For A Reason More on Stevia. Stevia: The One Beacon of Hope Diabetes and Aspartame The Precursor to Them All: An Informative History ... Not So Sweet Findings, Part 2 I Couldn't Resist... Brain Food. Far From It Not So Sweet Findings Acesulfame Potassium......Isn't that stuff in Bana... Sucralose Rhymes With.......Gross. The Next Generation: Pepsi's Latest Concoction Look How Much Artificial Sweetener the Average Ame... Artificial Sweeteners I What The Heck Are You Eati... Research on Rats and Weight Gain. Avoid Artificial Sweeteners Neotame: Aspartame on Steroids. Aspartame, Where does it come from and what is...
http://artificalsweeteners.blogspot.com/2013/05/artificial-sweeteners-i-what-heck-are.html
*  Advice from the Doc: Truth behind sugar substitutes - News - Sault Ste. Marie Evening News - Sault
... Ste. Marie, MI - Sault Ste. Marie, MI. Sault Ste. Marie Evening News - Sault Ste. Marie, MI. Posted Feb. Posted Feb. This, of course, also applies to sugar substitutes, and they are often the subject of various opinions on the internet, in newspapers, magazines, books and elsewhere, claiming that they cause a variety of health problems, including cancer. After a careful review of the many scientific studies available regarding sugar substitutes, the claims that they cause any health problems at all are shown to be completely untrue, and they have no basis in scientific fact. As noted below, the very well researched findings of the noted National Cancer Institute is quoted on the Mayo Clinic website, as they point out that many studies confirm that these sugar substitutes are perfectly safe for the general population. The following statement is from the prestigious Mayo Clinic website discussion on sugar substitutes According to the National Cancer Institute and other health agencies, there's no sound...
http://sooeveningnews.com/article/20120206/NEWS/302069991/1011/ENTERTAINMENTLIFE
*  High-fructose corn syrup: how to fight back against it and other sweeteners | Examiner.com
High-fructose corn syrup: how to fight back against it and other sweeteners. Examiner.com. Report this ad. In Life:. Home Living. Health Fitness. Facebook. Twitter. Google Plus. Life Health Fitness Weight Loss Dieting High-fructose corn syrup: how to fight back against it and other sweeteners. Facebook Twitter Pinterest. Linkedin Google Plus Comment. Sugar. Artificial. Artificial. Artificial. Right now the focus is on high-fructose corn syrup. If you haven't heard, it's artificial, it's natural, it's worse than sugar, it's the same as sugar, it causes diabetes, it has no effect on diabetes - depending on whether you're reading sweetscam.com or sweetsurprise.com. High-fructose corn syrup HFCS is chemically similar to other artificial sweeteners, and as such carries the same risk factors. HFCS is a preservative that adds shelf life to foods it is used in. It also can be used to replace up to a third of the white sugar content in foods. Americans in general eat too much sugar and caloric sweeteners. This is the ...
http://examiner.com/article/high-fructose-corn-syrup-how-to-fight-back-against-it-and-other-sweeteners
*  .. Q and A .. .. .. Q and A .. Q and A .. Myth .. Fact .. Myth .. Fact
next. previous. A: Foods and beverages use many types of low-calorie sweeteners. Despite some of the internet myths that may end up in your inbox, these low-calorie sweeteners are safe. In fact, they have been approved by regulatory agencies around the world, including the World Health Organization, U.S. Food and Drug Administration FDA and the European Food Safety Authority EFSA, as safe for use in foods and beverages. Read More. TAGS: low-calorie sweeteners. SHARE:. Q and A. Q: Does aspartame, a low-calorie sweetener used in diet beverages, cause cancer. A: No. People have safely consumed products containing aspartame for more than thirty years. In fact, since aspartame was first introduced, no scientific evidence has been found linking it to any disease in humans. Read More. TAGS: low-calorie sweeteners. SHARE:. The obesity epidemic can be reversed if people stop drinking soda. Sugar-sweetened beverages account for only 6% of calories in the average American's diet, according to government data. Read More....
http://letsclearitup.org/
*  Princeton University - A sweet problem: Princeton researchers find that high-fructose corn syrup pro
... mpts considerably more weight gain. Skip over navigation View Access Keys. Email. A to Z. Contacts. Site Map. News. Multimedia. Search Topics and People. Shortcuts Other News Emergency Info Media Central Event Streaming Public Events Calendar. Faculty News Student Publications The Daily Princetonian Campus Media Local News World News. About Princeton. Academics. Admission Aid. Arts. International. Library. Research. . Administration Services. Campus Life. Visiting Campus. Students. Faculty Staff. Alumni. Parents Families. Undergraduate Applicants. Graduate School Applicants. Mobile Princeton Web App. Mobile Princeton App for Android. Mobile Princeton App for iOS. Connect Subscribe Home » News » Archive » A sweet problem: Princeton researchers find that high-fructose corn syrup prompts considerably more weight gain. News at Princeton Friday, Oct. 02, 2015. News Stories. FAQs. Events Calendars. Multimedia. For News Media. Share Your News Current Stories. Features. Science Tech. People. Emergency Alerts. Uni...
https://princeton.edu/main/news/archive/S26/91/22K07/index.xml?from=2011-01-01&to=2011-02-01
*  Artificial sweeteners: Any effect on blood sugar? - Mayo Clinic
Artificial sweeteners: Any effect on blood sugar. - Mayo Clinic. Diseases and Conditions Diabetes. Can I use artificial sweeteners if I have diabetes. You can use most sugar substitutes if you have diabetes, including:. Artificial sweeteners, or sugar substitutes, offer the sweetness of sugar without the calories. This is why foods made with artificial sweeteners may have fewer calories than those made with sugar. Sugar substitutes don't affect your blood sugar level. In fact, most artificial sweeteners are considered free foods foods containing less than 20 calories and 5 grams or less of carbohydrates because they don't count as calories or carbohydrates on a diabetes exchange. Remember, however, other ingredients in foods containing artificial sweeteners can still affect your blood sugar level. Sugar alcohols can increase your blood sugar level. Journal of the American Medical Association. American Diabetes Association. http://www.diabetes.org/food-and-fitness/food/what-can-i-eat/artificial-sweeteners/. Ac...
http://mayoclinic.org/diseases-conditions/diabetes/expert-answers/artificial-sweeteners/faq-20058038?p=1
*  Prison Planet.com » Mercury Found in High-Fructose Corn Syrup
Prison Planet.com Mercury Found in High-Fructose Corn Syrup. World News. Social Alex Jones Twitter. Alex Jones Facebook. Featured Stories World News Commentary Money Watch Multimedia Prison Planet U.S. News Science And Technology Mercury Found in High-Fructose Corn Syrup. High-fructose corn syrup has taken our food shelves by storm. Recently, two separate studies, one published in the journal Environmental Health and the other conducted by the Institute for Agriculture and Trade Policy IATP, have revealed a further danger of high-fructose corn syrup, having found that it may contain mercury. Environmental Health Study. In the report of the first study, it was noted that mercury cell chlor-alkali products are used to make many food ingredients; these include citrus acid, sodium benzoate, as well as high-fructose corn syrup. An Environmental Health Officer EHO thus conducted an investigation in 2004, which revealed that both mercury grade and membrane grade caustic soda were used by the industry to manufacture ...
http://prisonplanet.com/mercury-found-in-high-fructose-corn-syrup.html
*  Yoplait Light changing artificial sweeteners | News OK
Yoplait Light changing artificial sweeteners. Business. × NewsOK Log In. Follow @newsok. Share “Yoplait Light changing artificial sweeteners”. Business News: US Yoplait Light changing artificial sweeteners. Published on NewsOK. Modified: June 25, 2014 at 11:10 am Published: June 25, 2014. General Mills Inc. said Wednesday it plans to remove aspartame from its popular reduced-calorie yogurt in favor of another artificial sweetener, sucralose. "We know that some consumers have concerns about aspartame, so this is a positive transition," General Mills CEO Ken Powell said in a phone interview. Although sucralose is also an artificial sweetener, Powell said it has greater acceptance among consumers. The change comes as General Mills struggles to fix its Yoplait business, which has been upended by the popularity of Greek yogurt and the move toward ingredients people feel are natural. Last year, retail sales for Yoplait Light fell in the "low double digits," while full-calorie Yoplait showed improvement after Genera...
http://newsok.com/yoplait-light-changing-artificial-sweeteners/article/feed/704191?custom_click=rss
*  .. Worse Than Sugar: High – Fructose Corn Syrup .. Post navigation
Worse Than Sugar: High – Fructose Corn Syrup. 1 Reply. Jonathan Galland. . High-fructose corn syrup HFCS is back in the news. A research team from Princeton has concluded that high-fructose corn syrup outdoes sugar when it comes to increasing body fat .Â. . Just to be clear, sugar causes a lot of trouble–raising inflammation and contributing to insulin resistance, diabetes and obesity.Â. . But according to some research, high-fructose corn syrup is even worse. . It might seem that this much maligned sweeter would have seen its day. Instead, high-fructose corn syrup continues to be a powerhouse, sweetening soft drinks like Coke and Pepsi and sports drinks like Gatorade. HFSC is the frosting on Frosted Flakes, and the syrup in Hershey’s Chocolate Flavor Syrup. It adds a touch of sweetness to Heinz ketchup, and provides stickiness to barbeque sauce. . The connection between high-fructose corn syrup and obesity has been explored in studies conducted at research centers in locations such as Louisiana State Un...
http://pilladvised.com/2010/05/worse-than-sugar-high-fructose-corn-syrup/

Sucrose gap: The sucrose gap technique is used to create a conduction block in nerve or muscle fibers. A high concentration of sucrose is applied to the extracellular space to increase resistance between two groups of cells, which prevents the correct opening and closing of sodium and potassium channels.Buoyant density ultracentrifugation: Buoyant density centrifugation uses the concept of buoyancy to separate molecules in solution. Usually a caesium chloride (CsCl) solution is used, but in the general case it's usually approximately the same density as the molecules that are to be centrifuged.Sweetness: Sweetness is one of the five basic tastes and is universally regarded as a pleasurable experience, except perhaps in excess. Foods rich in simple carbohydrates such as sugar are those most commonly associated with sweetness, although there are other natural and artificial compounds that are sweet at much lower concentrations, allowing their use as non-caloric sugar substitutes.Invertase: Invertase is an enzyme that catalyzes the hydrolysis (breakdown) of sucrose (table sugar). Alternate names for invertase include , saccharase, glucosucrase, beta-h-fructosidase, beta-fructosidase, invertin, sucrase, maxinvert L 1000, fructosylinvertase, alkaline invertase, acid invertase, and the systematic name: beta-fructofuranosidase.Abscisate beta-glucosyltransferase: Abscisate beta-glucosyltransferase (, ABA-glucosyltransferase, ABA-GTase, AOG) is an enzyme with system name UDP-D-glucose:abscisate beta-D-glucosyltransferase. This enzyme catalyses the following chemical reactionTaste: Taste, gustatory perception, or gustationAdjectival form: [is the sensory impression of food] or other substances on the tongue and is one of the [[sense|five traditional senses.Fructose malabsorptionStarch gelatinization: Starch gelatinization is a process of breaking down the intermolecular bonds of starch molecules in the presence of water and heat, allowing the hydrogen bonding sites (the hydroxyl hydrogen and oxygen) to engage more water. This irreversibly dissolves the starch granule in water.Isomaltooligosaccharide: Isomaltooligosaccharide (IMO) is a mixture of short-chain carbohydrates which has a digestion-resistant property. IMO is found naturally in some foods, as well as being manufactured commercially.FODMAP: FODMAPs are short chain carbohydrates (oligosaccharides), disaccharides, monosaccharides and related alcohols that are poorly absorbed in the small intestine. These include short chain (oligo-) saccharide polymers of fructose (fructans) and galactose (galactans), disaccharides (lactose), monosaccharides (fructose), and sugar alcohols (polyols) such as sorbitol, mannitol, xylitol and maltitol.Sucrase: Sucrase is the name given to a number of enzymes located in on the brush border of the small intestine that catalyze the hydrolysis of sucrose to fructose and glucose. The enzyme invertase, which occurs more commonly in plants, also hydrolyzes sucrose but by a different mechanism.Carbohydrate loading: Carbohydrate loading, commonly referred to as carb-loading or carbo-loading, is a strategy used by endurance athletes, such as marathon runners, to maximize the storage of glycogen (or energy) in the muscles and liver.http://www.Cell fractionation: Cell fractionation is the separation of homogeneous sets from a larger population of cells.Iron sucroseHappy Tooth: 72px|thumb|right|"Happy Tooth" logoStreptococcus mutans: Streptococcus mutans is facultatively anaerobic, Gram-positive coccus-shaped bacterium commonly found in the human oral cavity and is a significant contributor to tooth decay.High maltose corn syrup: High maltose corn syrup is a food additive used as a sweetener and preservative. The majority sugar is maltose.Sieve tube elementMolar mass distribution: In linear polymers the individual polymer chains rarely have exactly the same degree of polymerization and molar mass, and there is always a distribution around an average value. The molar mass distribution (or molecular weight distribution) in a polymer describes the relationship between the number of moles of each polymer species (Ni) and the molar mass (Mi) of that species.Burst kinetics: Burst kinetics is a form of enzyme kinetics that refers to an initial high velocity of enzymatic turnover when adding enzyme to substrate. This initial period of high velocity product formation is referred to as the "Burst Phase".RaffinoseFructokinase: Fructokinase (/fruc•to•ki•nase/ [-ki´nas]) (), also known as D-fructokinase or D-fructose (D-mannose) kinase,DBGET ENZYME: 2.7.List of glycoside hydrolase families: Glycoside hydrolases (O-Glycosyl hydrolases) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of numerous different families.Halotolerance: Halotolerance is the adaptation of living organisms to conditions of high salinity.Walter Larcher, 2001 Halotolerant species tend to live in areas such as hypersaline lakes, coastal dunes, saline deserts, salt marshes, and inland salt seas and springs.Alpha,alpha-trehalose synthase: Alpha,alpha-trehalose synthase (, trehalose synthase, trehalose synthetase, UDP-glucose:glucose 1-glucosyltransferase, TreT, PhGT) is an enzyme with system name ADP-glucose:D-glucose 1-alpha-D-glucosyltransferase. This enzyme catalyses the following chemical reactionElectrogustometry: Electrogustometry is the measurement of taste threshold by passing controlled anodal current through the tongue. When current passes through the tongue a unique and distinct metallic taste is perceived.Glucose transporterQuinine total synthesis: 400px|right|quinine carbon atom numbering scheme left and asymmetric centers rightLow-voltage electron microscope: Low-voltage electron microscope (LVEM) is an electron microscope which operates at accelerating voltages of a few kiloelectronvolts or less. While the low voltage electron microscopy technique will never replace conventional high voltage electron microscopes, it is quickly becoming appreciated for many different disciplines.Carbohydrate chemistry: Carbohydrate chemistry is a subdiscipline of chemistry primarily concerned with the synthesis, structure, and function of carbohydrates. Due to the general structure of carbohydrates, their synthesis is often preoccupied with the selective formation of glycosidic linkages and the selective reaction of hydroxyl groups; as a result, it relies heavily on the use of protecting groups.AspartameColes PhillipsCryoprotectant: A cryoprotectant is a substance used to protect biological tissue from freezing damage (i.e.Disaccharide: A disaccharide or bioseBiose on www.merriam-webster.Canna Leaf Roller: Cannas are largely free of pests, but in the USA plants sometimes fall victim the Canna Leaf Roller, which can actually be two different insects. Larva of the Brazilian skipper butterfly (Calpodes ethlius), also known as the Larger Canna Leaf Roller, cut the leaves and roll them over to live inside while pupating and eating the leaf.Eagle's minimal essential medium: Eagle's minimal essential medium (EMEM) is a cell culture medium developed by Harry Eagle that can be used to maintain cells in tissue culture.Xuzhou Medical CollegeAlkaliphile: Alkaliphiles are a class of extremophilic microbes capable of survival in alkaline (pH roughly 8.5-11) environments, growing optimally around a pH of 10.Leifsonia xyli xyli: Leifsonia xyli subsp. xyli is a small, fastidious, Gram-positive, coryneform bacterium that causes ratoon stunting disease, a major worldwide disease of sugarcane.Squamosa promoter binding protein: The SQUAMOSA promoter binding protein-like (SBP or SPL) family of transcription factors are defined by a plant-specific DNA-binding domain. The founding member of the family was identified based on its specific in vitro binding to the promoter of the snapdragon SQUAMOSA gene.Glycoside hydrolase family 66: In molecular biology, glycoside hydrolase family 66 is a family of glycoside hydrolases.Cell membraneMediated transportSalting in: Salting in refers to the effect where increasing the ionic strength of a solution increases the solubility of some solute (such as a protein). This effect tends to be observed at lower ionic strengths.Decyl polyglucose: Decyl polyglucose is a mild non-ionic synthetic surfactant. It is a type of alkylpolyglycoside derived from glucose or starch and the fatty alcohol decanol.Tritium illumination: Tritium illumination is the use of gaseous tritium, a radioactive isotope of hydrogen, to create visible light. Tritium emits electrons through beta decay, and, when they interact with a phosphor material, fluorescent light is created, a process called radioluminescence.Outline of water: The following outline is provided as an overview of and topical guide to water:Tripartite ATP-independent periplasmic transporter: Tripartite ATP-independent periplasmic transporters (TRAP transporters) are a large family of solute transporters found in bacteria and archaea, but not in eukaryotes, that appear to be specific for the uptake of organic acids. They are unique in that they utilize a substrate binding protein (SBP) in combination with a secondary transporter.Margaret Jope: Margaret Jope (1913–2004) was a Scottish biochemist, born as Henrietta Margaret Halliday in Peterhead, Scotland.Oncotic pressure: Oncotic pressure, or colloid osmotic pressure, is a form of osmotic pressure exerted by proteins, notably albumin, in a blood vessel's plasma (blood/liquid) that usually tends to pull water into the circulatory system. It is the opposing force to capillary filtration pressure and interstitial colloidal osmotic pressure.Steptoean positive carbon isotope excursion: The Steptoean Positive Carbon Isotope Excursion (SPICE) was a geological event which occurred about 500 million years ago at the end of the Cambrian Period. The SPICE event was a sudden reversal of the anoxia (lack of oxygen) that had steadily spread throughout the oceans during the Cambrian which also affected the atmosphere.

(1/4572) Interaction of inflammatory cells and oral microorganisms. II. Modulation of rabbit polymorphonuclear leukocyte hydrolase release by polysaccharides in response to Streptococcus mutans and Streptococcus sanguis.

The release of lysosomal hydrolases from polymorphonuclear leukocytes (PMNs) has been postulated in the pathogenesis of tissue injury in periodontal disease. In the present study, lysosomal enzyme release was monitored from rabbit peritoneal exudate PMNs exposed to Streptocccus mutans or Streptococcus sanguis. S. mutans grown in brain heart infusion (BHI) broth failed to promote significant PMN enzyme release. S. sanguis grown in BHI broth, although more effective than S. mutants, was a weak stimulus for promotion of PMN hydrolase release. Preincubation of washed, viable S. mutans in sucrose or in different-molecular-weight dextrans resulted in the ability of the organisms to provoke PMN release reactions. This effect could bot be demonstrated with boiled or trypsinized S. mutans or with viable S. sanguis. However, when grown in BHI broth supplemented with sucrose, but not with glucose, both S. mutans and S. sanguis triggered discharge of PMN enzymes. The mechanism(s) whereby dextran or sucrose modulates PMN-bacterial interaction may in some manner be related to promotion of microbial adhesiveness or aggregation by dextran and by bacterial synthesis of glucans from sucrose.  (+info)

(2/4572) Survey of total error of precipitation and homogeneous HDL-cholesterol methods and simultaneous evaluation of lyophilized saccharose-containing candidate reference materials for HDL-cholesterol.

BACKGROUND: Standardization of HDL-cholesterol is needed for risk assessment. We assessed for the first time the accuracy of HDL-cholesterol testing in The Netherlands and evaluated 11 candidate reference materials (CRMs). METHODS: The total error (TE) of HDL-cholesterol measurements was assessed in native human sera by 25 Dutch clinical chemistry laboratories. Concomitantly, the suitability of lyophilized, saccharose-containing CRMs (n = 11) for HDL-cholesterol was evaluated. RESULTS: In the precipitation method group, which included 25 laboratories and four methods, the mean (minimum-maximum) TE was 11.5% (2.7-25.2%), signifying that 18 of 25 laboratories satisfied the TE goal of +info)

(3/4572) Purification and characterization of rat hippocampal CA3-dendritic spines associated with mossy fiber terminals.

We report a revised and improved isolation procedure for CA3-dendritic spines, most of them still in association with mossy fiber terminals resulting in a 7.5-fold enrichment over nuclei and a 29-fold enrichment over myelin. Additionally, red blood cells, medullated fibers, mitochondria and small synaptosomes were significantly depleted. We show by high resolution electron microscopy that this subcellular fraction contains numerous dendritic spines with a rich ultrastructure, e.g. an intact spine apparatus, membranous organelles, free and membrane-bound polyribosomes, endocytic structures and mitochondria. This improved experimental system will allow us to study aspects of post-synaptic functions at the biochemical and molecular level.  (+info)

(4/4572) Site-directed mutagenesis of loop L3 of sucrose porin ScrY leads to changes in substrate selectivity.

The difference in substrate selectivity of the maltodextrin (LamB) and sucrose (ScrY) porins is attributed mainly to differences in loop L3, which is supposed to constrict the lumen of the pores. We show that even a single mutation (D201Y) in loop L3 leads to a narrowing of the substrate range of ScrY to that resembling LamB. In addition, we removed the putative N-terminal coiled-coil structure of ScrY and studied the effect of this deletion on sucrose transport.  (+info)

(5/4572) Characterization of the divergent sacBK and sacAR operons, involved in sucrose utilization by Lactococcus lactis.

The divergently transcribed sacBK and sacAR operons, which are involved in the utilization of sucrose by Lactococcus lactis NZ9800, were examined by transcriptional and gene inactivation studies. Northern analyses of RNA isolated from cells grown at the expense of different carbon sources revealed three sucrose-inducible transcripts: one of 3.2 kb containing sacB and sacK, a second of 3.4 kb containing sacA and sacR, and a third of 1.8 kb containing only sacR. The inactivation of the sacR gene by replacement recombination resulted in the constitutive transcription of the sacBK and sacAR operons in the presence of different carbon sources, indicating that SacR acts as a repressor of transcription.  (+info)

(6/4572) Oligofructose stimulates calcium absorption in adolescents.

BACKGROUND: In rats, nondigestible oligosaccharides stimulate calcium absorption. Recently, this effect was also found in human subjects. OBJECTIVE: The objective of the study was to investigate whether consumption of 15 g oligofructose/d stimulates calcium absorption in male adolescents. DESIGN: Twelve healthy, male adolescents aged 14-16 y received, for 9 d, 15 g oligofructose or sucrose (control treatment) daily over 3 main meals. The treatments were given according to a randomized, double-blind, crossover design, separated by a 19-d washout period. On the 8th day of each treatment period, 44Ca was given orally with a standard breakfast containing approximately 200 mg Ca. Within half an hour after administration of 44Ca, 48Ca was administered intravenously. Fractional calcium absorption was computed from the enrichment of 44Ca:43Ca and 48Ca:43Ca in 36-h urine samples, which was measured by inductively coupled plasma mass spectrometry. RESULTS: An increase in true fractional calcium absorption (%) was found after consumption of oligofructose (mean difference +/- SE of difference: 10.8+/-5.6; P < 0.05, one sided). The results are discussed in relation to the methods used. CONCLUSION: Fifteen grams of oligofructose per day stimulates fractional calcium absorption in male adolescents.  (+info)

(7/4572) Rapid induction of functional and morphological continuity between severed ends of mammalian or earthworm myelinated axons.

The inability to rapidly restore the loss of function that results from severance (cutting or crushing) of PNS and CNS axons is a severe clinical problem. As a novel strategy to help alleviate this problem, we have developed in vitro procedures using Ca2+-free solutions of polyethylene glycol (PEG solutions), which within minutes induce functional and morphological continuity (PEG-induced fusion) between the cut or crushed ends of myelinated sciatic or spinal axons in rats. Using a PEG-based hydrogel that binds to connective tissue to provide mechanical strength at the lesion site and is nontoxic to nerve tissues in earthworms and mammals, we have also developed in vivo procedures that permanently maintain earthworm myelinated medial giant axons whose functional and morphological integrity has been restored by PEG-induced fusion after axonal severance. In all these in vitro or in vivo procedures, the success of PEG-induced fusion of sciatic or spinal axons and myelinated medial giant axons is measured by the restored conduction of action potentials through the lesion site, the presence of intact axonal profiles in electron micrographs taken at the lesion site, and/or the intra-axonal diffusion of fluorescent dyes across the lesion site. These and other data suggest that the application of polymeric fusiogens (such as our PEG solutions), possibly combined with a tissue adherent (such as our PEG hydrogels), could lead to in vivo treatments that rapidly and permanently repair cut or crushed axons in the PNS and CNS of adult mammals, including humans.  (+info)

(8/4572) Stimulation of collagen galactosyltransferase and glucosyltransferase activities by lysophosphatidylcholine.

Lysophosphatidylcholine stimulated the activities of collagen galactosyl- and glucosyl-transferases in chick-embryo extract and its particulate fractions in vitro, whereas essentially no stimulation was noted in the high-speed supernatant, where the enzymes are soluble and membrane-free. The stimulatory effect of lysophosphatidylcholine was masked by 0.1% Triton X-100. In kinetic experiments lysophosphatidylcholine raised the maximum velocities with respect to the substrates and co-substrates, whereas no changes were observed in the apparant Km values. Phospholipase A preincubation of the chick-embryo extract resulted in stimulation of both transferase activities, probably gy generating lysophosphatides from endogenous phospholipids. No stimulation by lysophosphatidylcholine was found when tested with 500-fold-purified glycosyltransferase. The results suggest that collagen glycosyltransferases must be associated with the membrane structures of the cell in order to be stimulated by lysophosphatidylcholine. Lysophosphatidylcholine could have some regulatory significance in vivo, since its concentration in the cell is comparable with that which produced marked stimulation in vitro.  (+info)


what is the difference between sucrose and aspartame?


I want to cut out aspartame out of my diet but I've noticed that many foods  contain sucrose.  Is sucrose a  form of aspartame? Is it just as bad?
----------

Sucrose (common name: table sugar, also called saccharose) is a disaccharide of glucose and fructose, with the molecular formula C12H22O11. Its systematic name is α-D-glucopyranosyl- (1↔2)-β-D-fructofuranoside (ending in "oside", because it's not a reducing sugar). It is best known for its role in human nutrition and is formed by plants but not by other organisms such as animals.

Aspartame (or APM) (pronounced /ˈæspɚteɪm/ or /əˈspɑrteɪm/) is the name for an artificial, non-saccharide sweetener, aspartyl-phenylalanine-1-methyl ester; that is, a methyl ester of the dipeptide of the amino acids aspartic acid and phenylalanine.


Can honey increase blood sugar level? What is the difference between fructose and sucrose? ?


Which foods result in sucrose or fructose?  Which one is good for a diabetic?
----------

Yes! Honey is still high in sugar. 

Sucrose common name: table sugar
http://en.wikipedia.org/wiki/Sucrose 

Fructose (read more at the link below)http://en.wikipedia.org/wiki/Fructose


What is the difference between fructose and sucrose?


I know that fructose is better for health because it is natural, and because it is the type of sugar we find in fruits. On the other hand, we should not consume too many fruits if we don't want to put on weight because of all the sugar that there is in them. Then how is a chocolate bar with fructose better for health than a chocolate bar with sucrose? Is the one with fructose better for health but still likely to make you gain weight?
----------

Glucose is simple sugar, fructose is fruit sugar, and sucrose is a glucose molecule bonded to a fructose molecule.

As for "not consuming too many fruits if we don't want to put on weight because of all the sugar" this is pure mis-information. Consuming whole fruits, such as apples, oranges, bananas, grapes and so on, is preferable to drinking fruit juice. This is owing to the dietary fibre available in the whole fruit, which is removed with the pulp when the fruit is juiced. Fruit juice is, however, better for you than soda.


What is the difference between glucose sucrose dextrose and maltose?


I need this for a research paper of mine. What is the difference between glucose sucrose dextrose and maltose?
----------

Glucose is a monosaccharide.

Dextrose is the commercial name for crystaline glucose used as a food additive.  It is chemically the same as glucose.

Sucrose is a disaccharide consisting of a combination of one unit of glucose and one unit of fructose (another monosaccharide).

Maltose is a disaccharide consisting of two glucose units.

So sucrose and maltose are chemically a little more complicated than glucose.  But both are broken down into glucose by the digestive process.  Glucose is the only form of sugar that can be used by the human body to supply energy to the cells.


Why are endurance athletes encouraged to drink ensure when it has so much sucrose?


Joe Friel constantly says that many endurance athletes drink multiple bottles of ensure for breakfast the morning of their event.  

But ensure is mainly sucrose so wouldn't it simply give you a spike and then 2 hours later when your race begins bring you down?  Wouldn't you want something with more complex carbs?
----------

Neither.  Complex carbs and Ensure are both NOT the things to do for an endurance race.  A myth has become dogma and is being promoted by people who simply do NOT understand nutrition and how the body works.  Joe Friel is getting his information from the wrong people.  I would also look to see how big his check is from the Ensure company for promoting that junk.

FATS give you sustained energy and carbs, you are right, only give you quick, fleeting energy, even the complex carbs elicit Leptin hormone release and slow the metabolism down while creating high cortisol production that is fleeting energy.

Eating good protein and fats before a race and the night before will greatly improve the endurance of an athlete, not carbs.

good luck to you


Can you tell how much Sucrose is in a product from a label?


It normally lists Carbohydrates and then it lists sugars under that.
I am assuming they are talking about all types of sugars such as lactose, glutose, fructose, suctose
Am I right in thinking that?
Surely they should be listing Sucrose separately from the other sugars because that is the bad one.
Or do they count the other sugars under the Carbohydrate section even though it isn't technically correct?
----------

You assume right! 'Sugars' can mean any of the naturally occurring sweetening agents. Labelling regulations do not require them to list the individual types. The same applies to artificial sweeteners; they are not obliged to say if the agents are aspartame, saccharine, ar any other synthetic.


How can I get more sucrose into my son's diet?


My son's pediatrician recommend that I incorporate more sucrose into my son's diet to help repair a broken bone in his leg. Can you recommend any sucrose rich foods?
----------

Brown sugar, maple syrup, honey, mango, peach, cantaloupe, apricots, oranges, nectarines, gatorade/sprite/powerade. Most veggies and nuts contain a little bit too.


How can I get more sucrose into my son's diet?


My son's pediatrician recommend that I incorporate more sucrose into my son's diet to help repair a broken bone in his leg. Can you recommend any sucrose rich foods?
----------

Yesterday he recommended sodium. Troll