Satiation: Full gratification of a need or desire followed by a state of relative insensitivity to that particular need or desire.Satiety Response: Behavioral response associated with the achieving of gratification.Appetite: Natural recurring desire for food. Alterations may be induced by APPETITE DEPRESSANTS or APPETITE STIMULANTS.Eating: The consumption of edible substances.Nematocyst: A double-walled capsule found in jellyfish and other CNIDARIA whose functions include prey capture, defense, locomotion, and attachment. Nematocysts contain toxic CNIDARIAN VENOMS which are injected into the victim via a barbed tubule.Feeding Behavior: Behavioral responses or sequences associated with eating including modes of feeding, rhythmic patterns of eating, and time intervals.Hunger: The desire for FOOD generated by a sensation arising from the lack of food in the STOMACH.Fetishism (Psychiatric): A condition in which inanimate objects are utilized as a preferred or exclusive method of stimulating erotic arousal.Thirst: A drive stemming from a physiological need for WATER.Laminaria: A genus of BROWN ALGAE in the family Laminariaceae. Dried pencil-like pieces may be inserted in the cervix where they swell as they absorb moisture, serving as osmotic dilators.Appetite Regulation: Physiologic mechanisms which regulate or control the appetite and food intake.Gastric Emptying: The evacuation of food from the stomach into the duodenum.Food Preferences: The selection of one food over another.Cholecystokinin: A peptide, of about 33 amino acids, secreted by the upper INTESTINAL MUCOSA and also found in the central nervous system. It causes gallbladder contraction, release of pancreatic exocrine (or digestive) enzymes, and affects other gastrointestinal functions. Cholecystokinin may be the mediator of satiety.Dexfenfluramine: The S-isomer of FENFLURAMINE. It is a serotonin agonist and is used as an anorectic. Unlike fenfluramine, it does not possess any catecholamine agonist activity.Paraphilias: Disorders that include recurrent, intense sexually arousing fantasies, sexual urges, or behaviors generally involving nonhuman objects, suffering of oneself or partners, or children or other nonconsenting partners. (from DSM-IV, 1994)Acanthaceae: A plant family of the order Lamiales. It is characterized by simple leaves in opposite pairs, cystoliths (enlarged cells containing crystals of calcium carbonate), and bilaterally symmetrical and bisexual flowers that are usually crowded together. The common name for Ruellia of wild petunia is easily confused with PETUNIA.Stomach: An organ of digestion situated in the left upper quadrant of the abdomen between the termination of the ESOPHAGUS and the beginning of the DUODENUM.Food: Any substances taken in by the body that provide nourishment.Pedophilia: A sexual disorder occurring in a person 16 years or older and that is recurrent with intense sexually arousing fantasies, sexual urges, or behaviors involving sexual activity with a prepubescent child (generally age 13 or younger). (from APA, DSM-IV, 1994).Reinforcement (Psychology): The strengthening of a conditioned response.Area Postrema: A small, rounded eminence on each side of the FOURTH VENTRICLE, which receives nerve fibers from the SOLITARY NUCLEUS; SPINAL CORD; and adjacent areas of the MEDULLA OBLONGATA. The area postrema lies outside the BLOOD-BRAIN BARRIER and its functions include acting as an emetic chemoreceptor.Postprandial Period: The time frame after a meal or FOOD INTAKE.Solitary Nucleus: GRAY MATTER located in the dorsomedial part of the MEDULLA OBLONGATA associated with the solitary tract. The solitary nucleus receives inputs from most organ systems including the terminations of the facial, glossopharyngeal, and vagus nerves. It is a major coordinator of AUTONOMIC NERVOUS SYSTEM regulation of cardiovascular, respiratory, gustatory, gastrointestinal, and chemoreceptive aspects of HOMEOSTASIS. The solitary nucleus is also notable for the large number of NEUROTRANSMITTERS which are found therein.Flavoring Agents: Substances added to foods and medicine to improve the quality of taste.Conditioning, Operant: Learning situations in which the sequence responses of the subject are instrumental in producing reinforcement. When the correct response occurs, which involves the selection from among a repertoire of responses, the subject is immediately reinforced.Devazepide: A derivative of benzodiazepine that acts on the cholecystokinin A (CCKA) receptor to antagonize CCK-8's (SINCALIDE) physiological and behavioral effects, such as pancreatic stimulation and inhibition of feeding.Appetite Depressants: Agents that are used to suppress appetite.Peptide YY: A 36-amino acid peptide produced by the L cells of the distal small intestine and colon. Peptide YY inhibits gastric and pancreatic secretion.Sensation: The process in which specialized SENSORY RECEPTOR CELLS transduce peripheral stimuli (physical or chemical) into NERVE IMPULSES which are then transmitted to the various sensory centers in the CENTRAL NERVOUS SYSTEM.Glucagon-Like Peptide 1: A peptide of 36 or 37 amino acids that is derived from PROGLUCAGON and mainly produced by the INTESTINAL L CELLS. GLP-1(1-37 or 1-36) is further N-terminally truncated resulting in GLP-1(7-37) or GLP-1-(7-36) which can be amidated. These GLP-1 peptides are known to enhance glucose-dependent INSULIN release, suppress GLUCAGON release and gastric emptying, lower BLOOD GLUCOSE, and reduce food intake.Taste: The ability to detect chemicals through gustatory receptors in the mouth, including those on the TONGUE; the PALATE; the PHARYNX; and the EPIGLOTTIS.Vagus Nerve: The 10th cranial nerve. The vagus is a mixed nerve which contains somatic afferents (from skin in back of the ear and the external auditory meatus), visceral afferents (from the pharynx, larynx, thorax, and abdomen), parasympathetic efferents (to the thorax and abdomen), and efferents to striated muscle (of the larynx and pharynx).Extinction, Psychological: The procedure of presenting the conditioned stimulus without REINFORCEMENT to an organism previously conditioned. It refers also to the diminution of a conditioned response resulting from this procedure.Rhombencephalon: The posterior of the three primitive cerebral vesicles of an embryonic brain. It consists of myelencephalon, metencephalon, and isthmus rhombencephali from which develop the major BRAIN STEM components, such as MEDULLA OBLONGATA from the myelencephalon, CEREBELLUM and PONS from the metencephalon, with the expanded cavity forming the FOURTH VENTRICLE.PyrrolidinesDrinking: The consumption of liquids.Energy Intake: Total number of calories taken in daily whether ingested or by parenteral routes.Anorexia: The lack or loss of APPETITE accompanied by an aversion to food and the inability to eat. It is the defining characteristic of the disorder ANOREXIA NERVOSA.Intubation, Gastrointestinal: The insertion of a tube into the stomach, intestines, or other portion of the gastrointestinal tract to allow for the passage of food products, etc.Sodium Pertechnetate Tc 99m: A gamma-emitting radionuclide imaging agent used for the diagnosis of diseases in many tissues, particularly in the gastrointestinal system, cardiovascular and cerebral circulation, brain, thyroid, and joints.Reinforcement Schedule: A schedule prescribing when the subject is to be reinforced or rewarded in terms of temporal interval in psychological experiments. The schedule may be continuous or intermittent.Acetamides: Derivatives of acetamide that are used as solvents, as mild irritants, and in organic synthesis.Reward: An object or a situation that can serve to reinforce a response, to satisfy a motive, or to afford pleasure.Beverages: Liquids that are suitable for drinking. (From Merriam Webster Collegiate Dictionary, 10th ed)Motivation: Those factors which cause an organism to behave or act in either a goal-seeking or satisfying manner. They may be influenced by physiological drives or by external stimuli.Cross-Over Studies: Studies comparing two or more treatments or interventions in which the subjects or patients, upon completion of the course of one treatment, are switched to another. In the case of two treatments, A and B, half the subjects are randomly allocated to receive these in the order A, B and half to receive them in the order B, A. A criticism of this design is that effects of the first treatment may carry over into the period when the second is given. (Last, A Dictionary of Epidemiology, 2d ed)Receptors, Opioid, kappa: A class of opioid receptors recognized by its pharmacological profile. Kappa opioid receptors bind dynorphins with a higher affinity than endorphins which are themselves preferred to enkephalins.Sea Anemones: The order Actiniaria, in the class ANTHOZOA, comprised of large, solitary polyps. All species are carnivorous.Gastrointestinal Motility: The motor activity of the GASTROINTESTINAL TRACT.Single-Blind Method: A method in which either the observer(s) or the subject(s) is kept ignorant of the group to which the subjects are assigned.Duodenum: The shortest and widest portion of the SMALL INTESTINE adjacent to the PYLORUS of the STOMACH. It is named for having the length equal to about the width of 12 fingers.Rats, Long-Evans: An outbred strain of rats developed in 1915 by crossing several Wistar Institute white females with a wild gray male. Inbred strains have been derived from this original outbred strain, including Long-Evans cinnamon rats (RATS, INBRED LEC) and Otsuka-Long-Evans-Tokushima Fatty rats (RATS, INBRED OLETF), which are models for Wilson's disease and non-insulin dependent diabetes mellitus, respectively.Gastrointestinal Tract: Generally refers to the digestive structures stretching from the MOUTH to ANUS, but does not include the accessory glandular organs (LIVER; BILIARY TRACT; PANCREAS).Body Weight: The mass or quantity of heaviness of an individual. It is expressed by units of pounds or kilograms.Behavior, Animal: The observable response an animal makes to any situation.Energy Metabolism: The chemical reactions involved in the production and utilization of various forms of energy in cells.Obesity: A status with BODY WEIGHT that is grossly above the acceptable or desirable weight, usually due to accumulation of excess FATS in the body. The standards may vary with age, sex, genetic or cultural background. In the BODY MASS INDEX, a BMI greater than 30.0 kg/m2 is considered obese, and a BMI greater than 40.0 kg/m2 is considered morbidly obese (MORBID OBESITY).Choice Behavior: The act of making a selection among two or more alternatives, usually after a period of deliberation.Dyspepsia: Impaired digestion, especially after eating.

*  Food Science: Understanding Satiation and Satiety
: Understanding Satiation and Satiety. Top 100 Companies. Goya...
*  [Q] neuromodulation/satiation
neuromodulation/satiation. neuromodulation/satiation Mark R. ... : neuromodulation/satiation Next message: neuromodulation/satiation ... as a result of satiation in mammals. I seem to recall having...
*  Engorgements Synonyms, Engorgements Antonyms |
in repletion. as in satiation. as in satiety. prev next. deluge....
*  Satiation
... may refer to satiety feeling full and satisfied after eating the cessation of hunger see also cholecystokinin mediated satiety economic satiation where increasing the amount of a good reduces the worth of each individual unit of it predator satiation an anti predator adaptation involving high population densities of the prey semantic satiation where repetition of a word or phrase causes it to temporarily lose meaning pl nasycenie...
*  Patent US7121283 - Satiation devices and methods - Google Patents
... Publication date Oct 17, 2006. Satiation devices and methods US 7121283 B2 Abstract A device for inducing weight loss in a patient includes a tubular prosthesis self-expandable from a collapsed position in which the prosthesis has a first diameter to an expanded position in which the prosthesis has a second, larger, diameter. Patent Citations Cited Patent Filing date Publication date Applicant Title US4246893 Jul 5, 1978 Jan 27, 1981 Daniel Berson Inflatable gastric device for treating obesity. US4315509 Oct 16, 1978 Feb 16, 1982 Smit Julie A Insertion and removal catheters and intestinal tubes for restricting absorption. US4694827 Jan 14, 1986 Sep 22, 1987 Weiner Brian C Inflatable gastric device for treating obesity and method of using the same. US5327914 Sep 2, 1992 Jul 12, 1994 Shlain Leonard M Method and devices for use in surgical gastroplastic procedure. US5709657 Aug 4, 1993 Jan 20, 1998 Zimmon Science Corporation Methods for placement of balloon tamponade devices. US6146416 Sep 2, 1997 Nov 14, 2...,825,242
*  Sensory-specific satiety
... The term has been coined in 1981 Rolls BJ, Rolls ET, Rowe EA, Sweeney K. Postingestive feedback factors such as energy density and nutrient composition could affect the palatability of a food which in turn would inhibit or facilitate 'sensory-specific satiety'. Rolls 'et al.', summarized in a paper by Raynor and Epstein, show that postingesitive feedback does not influence 'sensory-specific satiety' very much. Since postingestive feedback seems to have little effect of sensory-specific satiety, it is probable that sensory-specific satiety is more driven by external factors, such as the sensory properties of the food, than internal factors. Obesity in relation to sensory-specific satiety. Studies have shown that eating monotonous meals limited variety in food results in long-term sensory-specific satiety. Effect of limiting snack food variety on long-term sensory-specific satiety and monotony during obesity treatment. On the contrary, sensory-specific satiety can also cause obesity because of the stimulat...
*  Satiety value
... multiple issues satiety value is the degree at which food gives a human the sense of food gratification the exact contrast feeling of hunger the concept of the satiety value and satiety index was developed by an australian researcher and doctor susanna holt holt sh miller jc petocz p farmakalidis e a satiety index of common foods eur j clin nutr highest satiety value is expected when the food that remains in the stomach for a longer period produces greatest functional activity of the organ limiting the food intake after reaching the satiety value helps reduce obesity problems foods with great satiety value cabbage as it does not contribute much to weight gain milk is considered as one of the rich products for higher satiety value green vegetables has the lowest satiety value when compared to milk and meat liquid foods have high satiating effect for a short period references see also polyphagia expected satiety values for foods further reading grimes d s and c gordon satiety value of wholemeal and white b...
*  Eating
... practices among humans Development of eating in humans Eating positions. Compulsive overeating. Hunger and satiety. People usually have two or three meals a day regularly. Small amounts of pureed food are sometimes fed to young infants as young as two or three months old, but most infants do not eat adult food until they are between six and eight months old. Between 8 and 12 months of age, the digestive system improves and many babies begin eating finger foods. Eating positions. 1 Compulsive overeating. Compulsive overeating. Another possible explanation would be that obese individuals do not eat more than the others while having meals due to social desirability. Hunger and satiety. thumb|200px|German Shepherd puppy eating out of a human hand There are numerous signals given off that initiate hunger. There are environmental signals, signals from the gastrointestinal system, and metabolic signals that trigger hunger. 2 The signals from the stomach are initiated by the release of the peptide hormone ghreli...
*  Conditioned satiety
... 'Conditioned satiety' is one of the three known food-specific forms of suppression of appetite for food by effects of eating, along with alimentary alliesthesia and sensory-specific satiety. 'Conditioned satiety' was first evidenced in 1955 Le Magnen J. in rats by the late French physiologist professor Jacques Le Magnen. Unlike the other two sorts of stimulus-specific satiety, this phenomenon is based on classical conditioning Booth DA, Davis JD. Booth DA. Booth DA. but is distinct from conditioned taste aversion CTA in its dependence on internal state towards the end of a meal. It has been widely misunderstood 1 as an association of the sensory properties of a food with its energy content calories or carbohydrate content. However that is a confusion with the conditioning of simple aversion or a contrast with simple conditioned preference. 'Conditioned satiety' has only been evidenced in experiments with rats, 2 monkeys 3 or humans 4 when a flavour and fullness together have been paired with concentrated...
*  Ingestive behaviors
... These actions are influenced by physiological regulatory mechanisms; these mechanisms exist to control and establish homeostasis within the human body. Satiety signals Short-term signals. Long-term signals. The increase of food intake by so many people is due primarily to a number of environmental factors. Main social environmental factors include: :* People who eat in groups tend to eat more than when they are by themselves :* When people eat in the presence of models who eat a lot or a little, they are likely to eat similarly to the model :* Individuals who eat in the presence of others who they think are watching them, tend to eat less than they do when they are by themselves. Along with social environmental factors, ingestive behaviors are also influenced by atmospheric environmental factors. Ghrelin also stimulates energy production and signals directly to the hypothalamus regulatory nucli that control energy homeostasis. There are two primary sources of signals that stop eating: short-term signals ...
*  Obesity Associated Genetic Variation in FTO Is Associated with Diminished Satiety (PDF Download Avai
However, to date, it is not known whether the association between genetic variation in FTO and obesity is mediated through effects on energy intake or energy expenditure. The intronic FTO single nucleotide polymorphism rs9939609 was genotyped in 3337 United Kingdom children in whom measures of habitual appetitive behavior had been assessed using two scales Satiety Responsiveness and Enjoyment of Food from the Child Eating Behaviour Questionnaire, a psychometric tool that has been validated against objective measures of food intake. Page 1 Obesity Associated Genetic Variation in FTO Is Associated with Diminished Satiety Jane Wardle, Susan Carnell, Claire M. However, to date, it is not known whether the association between genetic variation in FTO and obesity is mediated through effects on energy intake or energy expenditure. Association between FTO genotype, anthropometric, and appetitive measures in United Kingdom children from the TEDS cohort FTO genotype Group difference and ES F 1,3354. 487 17.91 17.25–18....
*  High-fat diet negatively impacts satiety, study says
Getbig Bodybuilding, Figure and Fitness Forums > Getbig Bodybuilding Boards > Nutrition, Products Supplements Moderators: Princess L , Necrosis , Montague > High-fat diet negatively impacts satiety, study says. High-fat diet negatively impacts satiety, study says on: September 20, 2013, 08:45:55 AM. Re: High-fat diet negatively impacts satiety, study says Reply #1 on: September 22, 2013, 06:19:12 AM. Re: High-fat diet negatively impacts satiety, study says Reply #2 on: September 22, 2013, 06:34:38 AM. Re: High-fat diet negatively impacts satiety, study says Reply #3 on: September 22, 2013, 06:40:05 AM. => Sports Discussion Boards => E-Board - Movies, Music, TV, Videogames, Comics => Pet Board => Industry Business Technology Board => The Getbiggers Board - The Lounge ----------------------------- Getbig Womens Area ----------------------------- => Figure, Bikini and Fitness Discussions => Womens Training / Womens Physique / Womens Bodybuilding => Open Talk for Girl Discussion ----------------------------- Getb...
*  6 Reasons Why a Calorie is NOT a Calorie
Bottom Line: Even though fructose and glucose have the same chemical formula, fructose has much more negative effects on hormones, appetite and metabolic health. The metabolic pathways for protein are less efficient than the metabolic pathways for carbs and fat. If we go with a thermic effect of 25% for protein and 2% for fat, this would mean that a 100 calories of protein would end up as 75 calories, while a 100 calories of fat would end up as 98 calories. Studies show that high protein diets boost metabolism by 80 to 100 calories per day, compared to lower protein diets 9, 10. Bottom Line: Protein calories are less fattening than calories from carbs and fat, because protein takes more energy to metabolize. In one study, those who increased their protein intake to 30% of calories automatically started eating 441 fewer calories per day and lost 4.9 kg 11 lbs in 12 weeks 16. Bottom Line: Increased protein can lead to drastically reduced appetite and cause automatic weight loss without the need for calorie coun...
*  Health & Wellness
You may already know that heart disease is the No. In addition, Mayo experts say, 10 simple steps can help you minimize your risk of heart disease. Here’s a sampling of the steps that you’ll find in the clinic’s new heart healthy book: • Eat healthy - Adopt simple dietary changes such as eating at least five fruits and vegetables each day, switching to whole grains and lean proteins, and eating a healthy breakfast every day. When it comes to eggs, dietary cholesterol and heart health, what you think you know may be a bit scrambled. Concerns over dietary cholesterol and its impact on heart disease keeps many people from eating eggs, despite their nutritional benefits. However, more than 40 years of research shows healthy adults can enjoy an egg every day without significantly impacting their risk of heart disease. In fact, according to USDA data, one large egg is 14 percent lower in cholesterol than previously recorded, down from 212 mg to 185 mg, and is also 64 percent higher in vitamin D, with 41 IU per larg...
*  Lower inflammation and improve satiety - Nutrition Express Articles
... Order 1-800-338-7979 24-hrs. Article Index > Newsletters > 2011 Newsletters > June 2011. Lower inflammation and improve satiety. by Newsletter Editor. Adipose tissue—the fatty layer under the skin and around organs—stores energy in the form of fat, and releases beneficial hormones that help the body regulate fat and sugar. Researchers reviewing recent findings said that omega-3s from fish oil improve these storage and release functions while reducing adipose tissue-specific inflammation, all central factors in metabolic syndrome. Omega-3s appear to raise blood levels of two key hormones secreted by adipose tissue: adiponectin, which regulates fat and sugar metabolism, and reduces blood vessel inflammation; and leptin, which signals the brain when the body has had enough to eat. Reference: The Journal of Nutritional Biochemistry; 2011, Vol. 22, No. 2, 101-8. Newsletters 1065. 2011 Newsletters 152. January 2011 13. February 2011 13. March 2011 15. April 2011 14. May 2011 14. June 2011 12. July 2011 14. Aug... index/newsletters/2011 newsletters/june 2011/showarticle.aspx?articleid=1472
*  Conditions listing symptom: Poor appetite - Letter S -
About Us Bookmark this page HOME SYMPTOMS DISEASES DIAGNOSIS VIDEOS TOOLS COMMUNITY MISDIAGNOSIS DOCTORS HOSPITALS DRUGS Poor appetite: Introduction Introduction: Poor appetite Videos about Poor appetite Deaths and Poor appetite Causes Causes of Poor appetite Medications causing Poor appetite Drug interactions causing Poor appetite Symptom Checker: Poor appetite Common causes of Poor appetite Travel-related causes of Poor appetite Diabetes-related causes of Poor appetite Treatments Treatments for Poor appetite Diagnosis Diagnostic tests for Poor appetite Poor appetite Assessment Questionnaire Home Diagnostic Testing Questions your Doctor May Ask (and Why) Misdiagnosis Misdiagnosis and Poor appetite Community News about Poor appetite Videos relating to Poor appetite Glossary Forums for Poor appetite Assessment Questionnaire Have a symptom? See what questions a doctor would ask. Choose... Rash Fever Pain Headache Fatigue Diarrhea All checklists Next Symptoms » Poor appetite » View-all Conditions lis...
*  Poor appetite - Treatment with chinese herbs for Poor appetite symptoms
... The most complete database on Chinese herbal medicine. Get a FREE account now and discover how to treat this symptom with Chinese medicine. POOR APPETITE. The following Chinese herbal formula s can treat or relief Poor appetite : Chinese Formula Actions Indications Symptoms related to poor appetite. Bei Xie Shen Shi Tang Dioscorea Hypoglauca Decoction to Eliminate Dampness. Clears Damp-Heat; Transforms Damp-Heat; Moves Blood; Cools Blood; Tonifies the Spleen; Diuretic. Damp-Heat rash. Blister; Chronic urticaria; Dermatitis; Gradual onset of skin rashes; Itching; Pale-red skin weepy after scratching ; Vesicular rash; Weeping eczema; Fatigue; Poor appetite; Sensation of heaviness; Tongue with white or yellow coating may be greasy ; Slippery-Rapid pulse Hua Shu. Shi Wei Wen Dan Tang Ten-Ingredient Decoction to Warm the Gallbladder. Transforms Phlegm; Calms the Mind. Heart and Gall-Bladder Deficiency. Anxiety; Apprehension; Fear; Irritability; Mental fragility; Oppression of the chest; Palpitations; Patient ...
*  daily caloric intake - How does calorie burn affect appetite? - Physical Fitness Stack Exchange
daily caloric intake - How does calorie burn affect appetite. - Physical Fitness Stack Exchange. Physical Fitness. Physical Fitness Meta. more stack exchange communities. Stack Exchange. Help Center Detailed answers to any questions you might have. Questions. Physical Fitness Stack Exchange is a question and answer site for physical fitness professionals, athletes, trainers, and those providing health-related needs. How does calorie burn affect appetite. What's the relationship of calories burned e.g. through exercise and appetite level. B I try to be more active and burn 2800 calories throughout the day but I eat 2300 calories worth of food. Perhaps another question in itself: will I lose the same amount of body fat in both scenarios. calories daily-caloric-intake hunger share. improve this question. 4 add a comment. 3 Answers 3 active oldest votes. 6 add a comment. up vote 1 down vote. Assuming the balance of protein/carbs/fats are the same, the only thing left is the net between calories burned and calorie...
*  New Joslin-led Study Uncovers Role of Appetite-Related Melanin Concentrating Hormone (MCH) in the Br
New Joslin-led Study Uncovers Role of Appetite-Related Melanin Concentrating Hormone MCH in the Brain to Beta Cell Growth and Insulin Secretion. dLifeTV. News. Everything Diabetes. Type 1 Diabetes. Type 2 Diabetes. Gestational Diabetes. Blood Sugar Management. Insulin. Type 1 Complications. About Type 1 Diabetes. Type 2 Complications. About Type 2 Diabetes. About Gestational Diabetes. Gestational Diabetes Causes. Carb Management. Diabetes and Exercise. About Insulin. Share New Joslin-led Study Uncovers Role of Appetite-Related Melanin Concentrating Hormone MCH in the Brain to Beta Cell Growth and Insulin Secretion. New Joslin-led Study Uncovers Role of Appetite-Related Melanin Concentrating Hormone MCH in the Brain to Beta Cell Growth and Insulin Secretion BOSTON January 25, 2007 A new Joslin Diabetes Center-led study shows conclusively that a neuropeptide, melanin concentrating hormone MCH, found in the brain and known for its role in increasing appetite in people, plays a role in the growth of insulin-produ...
*  How long does tyrosine extend the appetite suppression of EC? -
How long does tyrosine extend the appetite suppression of EC. - Home. News. Supplement News. Nutrition News. Weight Loss News. Training News. Men's Health News. Contest News. Research News. Forum. Ask A Question. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. Excerise Science. Main Forum. Supplement Forum. Company Promotions. Supplement Deals. Supplement Companies. Nutrition Forum. Weight Loss Forum. Training Forum. Bodybuilding Forum. General Chat. Stores. 1RM Supplements. Island Supplements. Mind & Muscle. Nutriverse. Nutraplanet. Orbit Supplements. PHW Supplements. Strong Supplements. TF Supplements. TGB Supplements. Photos. Album Gallery. Member Gallery. Picture Gallery. Add Album. Reviews. Close menu. Register. . Forum. Supplement Forum. Supplements. How long does tyrosine extend the appetite suppression of EC. How long does tyrosine extend the appetite suppression of EC. 11-29-2012, 04:03 AM. Mochaccino. How long does tyrosine extend the appet...
*  Buy SlimStyles PGX Appetite Control, 180 Capsules, 500 mg, From Natural Factors Slim Stylesat VitaMa
... Now. - Appetite Suppressant. Contact Us. Weight Loss Sports Nutrition Sexual Health Herbal Detox Herbs A-Z Brand A-Z Healthy Remedy Personal Care Organic Formula Baby Kids Massager & Vibrator. Shop by Brands Popular Weight Loss Fat Burners Apple Cider Vinegar Appetite Suppressant Cortisol Control Formula Carb Blocker Protein Powder Diet Protein Bar Diet Protein Shake Diet Tea Fat Blocker Sports Topical Gel Liquid Weight Loss Low Carb Food Thermogenic Wieght Loss. Diet and Weight Loss. Appetite Suppressant. SlimStyles PGX Appetite Control, 180 Capsules, 500 mg, From Natural Factors Slim Styles Home. Shop By Brand. Natural Factors. SlimStyles PGX Appetite Control, 180 Capsules, 500 mg, From Natural Factors Slim Styles. SlimStyles PGX Appetite Control, 180 Capsules, 500 mg, From Natural Factors Slim Styles. Read 4 review. Write Review. Customer Reviews PGX is a completely unique blend of highly purified soluble fibers processed using advanced proprietary technology. Compared to other soluble fibers, ...
*  Post Punk Kitchen Forum • View topic - Hearty Vegan Meals for Monster Appetites
Post Punk Kitchen Forum View topic - Hearty Vegan Meals for Monster Appetites. Post Punk Kitchen Forum. jdfunks Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Fri Oct 28, 2011 10:46 am. LaurenL Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Fri Oct 28, 2011 11:20 am. masuphl Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Fri Oct 28, 2011 11:27 am. Lactose Intolerant...Literally. queenofpainting Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Sun Nov 13, 2011 9:26 pm. Lactose Intolerant...Literally. boychucker Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Sat Nov 19, 2011 11:19 pm. Lactose Intolerant...Literally. Joined: Thu Oct 21, 2010 7:17 pm Posts: 703 Location: East Of L.A. A dozen donuts for two people is totally reasonable. A dozen donuts for just one person, also totally reasonable. veganwonder Post subject: Re: Hearty Vegan Meals for Monster Appetites - p.92 Posted: Tue Nov 29, 2011 6:...
*  Appetite-related chemical also affects drug-seeking: Hungry rats more resistant to drug relapse in a
... bsence of chemical signal -- ScienceDaily. Your source for the latest research news. Mobile. Follow. Subscribe. Breaking News :. Ancient Ocean Alga Was Pre-Set for Life On Land. Volcanic Eruptions Affect Flow of Major Rivers. Ocean Bacteria: Millions of Tons of Hydrocarbons. How the Brain Recognizes Objects. Chernobyl: The Animals Have Returned. Illegal Trade Puts Cacti On Most Threatened List. World's Largest Atom Smashers: Smallest Droplets. Crucial Hurdle Overcome in Quantum Computing. Your Visual Cortex Is Making Decisions. Anorexia Nervosa and Gut Bacteria Linked: Study. Science News from research organizations. Appetite-related chemical also affects drug-seeking: Hungry rats more resistant to drug relapse in absence of chemical signal. Date: January 19, 2011 Source: Society for Neuroscience Summary: A behavioral study of food-deprived rats shows that the animals were less likely to return to heroin-seeking habits when given a compound that blocks specific brain receptors. Share:. Total shares:. FULL...
*  Calories in Fullbar - Appetite Control Bar, Cocoa Dip | Nutrition and Health Facts
Calories in Fullbar - Appetite Control Bar, Cocoa Dip. Nutrition and Health Facts. Home Dashboard Calorie Camp Goals Friend Finder. Logging. Food Log Activity Log Weight Log Analysis Meals Favorites Recipes Custom Foods. Community. Forums Groups Journals Profile Mailbox. Foods. Overview Food Browser Recipe Browser New Recipe. Exercise. Overview Activity Browser Exercise Plan Workout Center Beginner's Corner. Tools. Overview Diet Profile BMI Tool Burn Meter Calorie Target Apps. Advice. Advice Experts Videos Q & A Books Versus. Blog. Blog Home Tips & Updates Dieting & You Success Stories Recipes Healthy Eating. Foods. Foods Activities Recipes Forums Groups. Create FREE Account Existing User: Login. Overview. Food Browser. Recipe Browser. New Recipe. The Hungry Girl Diet. Calories in Appetite Control Bar. Foods. Snacks. Snack Bars. Meal Replacement Bars. Wondering how many calories are in Appetite Control Bar. Manufactured by Fullbar. fullbar fullbar grams oz cal. Add to Log Appetite Control Bar. Appetite Contro...
*  NaturalCare Appetite 60 Caps - Swanson Health Products
... Cart Checkout $0.00. See all Categories. Top Brands Swanson. NOW Foods. See all Categories. Top Brands Swanson. Popular Categories Ubiquinol. CoQ10 Combination Formulas. See all Categories. Top Brands Swanson. NOW Foods. Popular Categories Turmeric. See all Categories. Top Brands Swanson. NOW Foods. Joint Health Combination Formulas. See all Categories. Top Brands Swanson. NOW Foods. Professional Lines Enjoy the convenience of shopping for the same great products you'd normally get at your doctor's office right here from Swanson. Shop an array of professional line therapeutic and healthcare products with the same quality and purity to meet all of your health goals. All Food Beverage Beauty CoQ10 Herbs Joint Immune Digestive Heart Sports Diet Professional Lines. Maximum strength appetite suppressant Homeopathic formulation Does not use caffeine or other stimulants Helps curb cravings for carbs and sweets NaturalCare Appetite is a safe, natural, maximum strength homeopathic formula to help curb appetite, r...
*  Appetite - decreased
 Appetite - decreased. Memorial Healthcare System. About Memorial Healthcare System. Health Services. Find a Physician. Health Library. Hollywood's Top Rated Hospital... Bariatrics/Weight-Loss Surgery. Cancer Institute. Home Health Services. Outpatient Services. Pediatrics. Pediatric Cancer. General Information... Patient- Family-Centered Care. Research a Disease or Condition. Learn About a Test. Memorial Services • Division of General Pediatrics at Joe DiMaggio Children's Hospital. Appetite - decreased Definition A decreased appetite is when you have a reduced desire to eat. Alternative Names Loss of appetite; Decreased appetite; Anorexia Considerations Any illness can affect a previously hearty appetite. Causes A decreased appetite is almost always seen among elderly adults, and no cause may be found. Cancers that may cause you to lose your appetite include: Colon cancer Ovarian cancer Stomach cancer Pancreatic cancer Other causes of decreased appetite include: Chronic liver disease Chronic kidney failure ... multimedia/1/003121.html
*  Medical Xpress - appetite
... Home appetite. News tagged with appetite. 1 day. Last day. 1 week. 1 month. Last day. 1 week. 1 month. Last day. 1 week. 1 month. Related topics: food intake · food · obesity. Diseases, Conditions, Syndromes. The three intestinal worms: roundworm Ascaris, whipworm Trichuris and hookworm, cause infections and diseases that are among the most common neglected tropical diseases in the developing world. Health. bean meals: Both provide similar feeling of fullness. Today vegetarians aren't the only group of consumers looking for foods that are meat-free and provide a satisfying meal. All types of consumers are looking to manage and maintain weight with plant-based meal options with ... Psychology & Psychiatry. Medications. Health. Although eating high-protein, afternoon snacks can aid appetite control in adults, little information exists to guide parents on what types of snacks might benefit their adolescent children. Medical research. Overweight and Obesity. Potential obesity treatment targets the two sides ...
*  Complete Formulas - Appetite Control - Diet - Nutrition Express
Order 1-800-338-7979 24-hrs. Category > Diet > Appetite Control > Complete Formulas Complete Formulas Appetite control formulas that supress cravings and reduce hunger to aid in weight loss Appetite control is a key weight loss strategy for those who tend to overeat or snack between meals. They suppress hunger, reduce cravings and give you greater control over how much you eat and when. Many appetite control formulas also contain metabolic cofactors to help sustain energy and productivity as your body adjusts to a reduced calorie intake. Recently-discovered ingredients like hoodia and Slimaluma mark the new generation of appetite control formulas; effective at promoting weight loss without side effects. Slimaluma is a unique extract of Caralluma Fimbriata, and has been shown to safely suppress appetite and promote weight-loss.* Hoodia has been also reported to effectively control appetite and suppress hunger.* Alphabetical Product List 2 Shredded Aqua Slender Detonate XT Diet Stack Dopamite Dren EpiBURN Pro w... control/complete formulas/gat german american technologies jetfuel accelerator 120 capsules.aspx
*  Appetite & Weight Control 2 oz King Bio Homeopathic - Compare Price and Reviews at
... FREE US ground shipping on orders over $100, and flat rate $6.99 on orders under $100. Some items include additional surcharge. Home. Info. Track. Return. Toll Free : 1-877-848-2168. We Ship To:. Live Stats: 67,168 Quality Products by 1,866 Premier Brands. Intimacy Enhancement. Diet Weight Loss. Sports Nutrition. Shop by Brand. Herbs Botanicals. Vitamins Minerals. Nutritional Supplements. Personal Care. Baby and Child Health. Pet Care. Shoes Lingeries. Perfume Cosmetics. Eletronics and Gifts. View More section. Search:. Home > Ultimate Get in Shape Formula > Appetite Suppressant > Appetite & Weight Control, 2 oz, From King Bio < < Prev. Next >>. Home > Shop by Brand > Shop By Brand K > King Bio Homeopathic > King Bio Weight > Appetite & Weight Control, 2 oz, From King Bio < < Prev. Next >>. Home > Shop by Brand > Shop By Brand K > King Bio Homeopathic > King Bio Homeopathic All > Appetite & Weight Control, 2 oz, From King Bio < < Prev. Next >>. Home > King Bio Homeopathic All > Appetit...
*  6 yr old with poor appetite and petite stature -Doctors Lounge(TM)
6 yr old with poor appetite and petite stature -Doctors Lounge TM. Search for:. News. Journals. Conferences. Blogs. Articles. Forums. Twitter. Home. Ask a Doctor. Medical Professional. Author. Volunteer. Medical Reference. Diseases. Symptoms. Labs. Procedures. Drugs. Medical Specialty. Cardiology. Dermatology. Endocrinology. Fertility. Gastroenterology. Gynecology. Hematology. Infections. Nephrology. Neurology. Oncology. Orthopedics. Pediatrics. Pharmacy. Primary Care. Psychiatry. Pulmonology. Rheumatology. Surgery. Urology. More ... Headlines:. Doctors Lounge - Pediatrics Answers The information provided on is designed to support, not replace, the relationship that exists between a patient/site visitor and his/her physician. Back to Pediatrics Answers List Forum Name: Pediatric Topics Question: 6 yr old with poor appetite and petite stature ltunes - Fri Mar 18, 2005 9:50 am. Share. I have a 6 year old daughter who currently weighs 32 pounds and is 36 inches tall. Her growth and weight h...
*  Children's Appetite Enhancer 2 oz King Bio Homeopathic (KingBio) King Bio Homeopathic - Compare Pri
Children's Appetite Enhancer 2 oz King Bio Homeopathic KingBio King Bio Homeopathic - Compare Price and Reviews at FREE US ground shipping on orders over $100, and flat rate $6.99 on orders under $100. Some items include additional surcharge. Home. Info. Track. Return. Toll Free : 1-877-848-2168. We Ship To:. Live Stats: 67,168 Quality Products by 1,866 Premier Brands. Intimacy Enhancement. Diet Weight Loss. Sports Nutrition. Shop by Brand. Herbs Botanicals. Vitamins Minerals. Nutritional Supplements. Personal Care. Baby and Child Health. Pet Care. Shoes Lingeries. Perfume Cosmetics. Eletronics and Gifts. View More section. Search:. Home > Ultimate Get in Shape Formula > Appetite Suppressant > Children's Appetite Enhancer, 2 oz, King Bio Homeopathic KingBio < < Prev. Next >>. Home > Shop by Brand > Shop By Brand K > King Bio Homeopathic > King Bio Weight > Children's Appetite Enhancer, 2 oz, King Bio Homeopathic KingBio < < Prev. Next >>. Home > Shop by Brand > Shop By Brand...
*  I have no appetite
... Anxiety Forums, Blogs & Support Groups. Anxiety Zone. Help. Member Groups. Member Blogs. Health News. Anxiety Zone Forums, Blogs Support Groups. I have no appetite. previous next Print. kercare Jr. Member. Posts: 86 Rec's: 0 Gender:. Personal text. I have no appetite on: May 11, 2014, 12:18:01 AM. I haven t had an appetite in nearly a week. I ve been to the doctor and my urine test came back fine, now I am just waiting on the blood test results. I have sinus problems and some acid reflux problems going on right now. Tweet Logged. Descent Full Member. Posts: 205 Country:. Rec's: 1 Gender:. Only thing to fear is fear itself. Re: I have no appetite Reply #1 on: May 11, 2014, 07:05:59 AM. If you have acid reflux problems, there could be some underlying gastritis even if you don t feel any stomach pain. I ve had a very noticeable lack of appetite and weight loss over the past couple months due to chronic gastritis partly due to reflux, anxiety problems and depression. Tweet Logged Generally afraid of: Bacteri...,87909.msg491241.html
*  Which PH effects your APPETITE the LEAST? -
Which PH effects your APPETITE the LEAST. - News. Supplement News. Nutrition News. Weight Loss News. Training News. Research News. Forum. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. Main Forum. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. PHW Supplements. Strong Supplements. TF Supplements. Album Gallery. Member Gallery. Picture Gallery. Forum. Anabolics. Which PH effects your APPETITE the LEAST. Which PH effects your APPETITE the LEAST. caliphotog. Which PH effects your APPETITE the LEAST. I finished a cycle of SPAWN and my appetite was out of control. I just could not eat enough food... I pack my cooler every day with the macros I need and I NEVER cheat or miss a meal. I am very good at controlling what and how much I eat. If I am not hungry and I need to eat, I eat. If I am hungry and I am not supposed to eat right then, I don't eat. Well, when I was on SPAWN I could not control myself!!. hahaha I promise you, the firs...
*  Appetite enhancers?? -
Appetite enhancers?. News. Supplement News. Nutrition News. Weight Loss News. Training News. Research News. Forum. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. 1RM Supplements. Island Supplements. Orbit Supplements. PHW Supplements. Strong Supplements. TF Supplements. TGB Supplements. Album Gallery. Member Gallery. Forum. Nutrition Forum. Bulking. Appetite enhancers?. Appetite enhancers?. 06-14-2013, 04:07 PM. MiniGun. Appetite enhancers?. What are some excellent appetite enhancers that work. 06-17-2013, 09:46 PM. PuZo. I know Controlled Labs has one called Black Hole.. not sure how well it works though. PES Representative Don't miss out on the next deal: Protein Backed by Science: 06-18-2013, 07:04 PM. Originally Posted by bolt10. much more than appetite increase. Good to know Bolt. I love SSv2 and am thinking of picking up ABE or AB+Forskolin-95 fo...
*  What is the best drug for enhancing appetite for my elderly father?
What is the best drug for enhancing appetite for my elderly father. Search:. All Consumer Professional Pill ID Interactions News FDA Alerts Approvals Pipeline Clinical Trials Care Notes Encyclopedia Dictionary Natural Products. Sign In. Sign In. Sign In. Drugs A-Z. Natural Products. News. Apps. Questions. banjoe What is the best drug for enhancing appetite for my elderly father. cancer, weight, elderly, appetite. Details: My father had esophagus cancer some eight years ago and lost a lot of weight. It,will help him to sleep and his appetite will most certainly be there. He will be putting on the weight, for its a very common normal side effect of the drug. nucproff 9 Jan 2012 Try jello, pudding with whole milk, icecream, high cal drinks like protein type drinks, lots of pedialyte for electolyte balance, try to keep his energy high and elevate his attitude. Combining the hi-cal foods with drinks will help weight gain, appetite may increase with the use of easier to swallow foods. nucproff 9 Jan 2012 The other ...
*  6 Foods That Suppress Your Appetite
... View Newsmax Mobile. Cancer. Heart. Brain Health. Diabetes. Natural Health. Anti-Aging. Diet Fitness. Health Wire. Newsletters. Tara Gidus. appetite suppression. enterogastrone. healthy fats. fiber. 6 Foods That Suppress Your Appetite. Close More ways to share... Comment. Contact. While experts agree that eating healthy meals and avoiding snacks during the day helps keep your weight in check, there are exceptions to the rule. Choosing snacks that are rich in healthy fat and fiber helps keep craving at bay so you ll actually eat less at meals, says Orlando-based nutritionist Tara Gidus. The effect of fiber as a hunger suppressant actually starts the moment you take a bite, adds Gidus, nutritionist for the Orlando Magic basketball team. If you are trying to lose weight, but find yourself plagued by hunger pangs, there are certain foods that can help you curb your appetite. Here, according to Gidus and other diet experts, are top foods for fighting hunger:. These excellent snacks are both high in fat and fi...
*  Brain research reveals new link between high intensity exercise and appetite
... January 31, 2014 Brain research reveals new link between high intensity exercise and appetite January 31, 2014 by Kelly Potts. High intensity exercise suppresses yearnings for unhealthy foods, a study by Aberdeen nutritionists has found. Medical Xpress —High intensity exercise suppresses yearnings for unhealthy foods, a study by Aberdeen nutritionists has found. We are more inclined to select low calorie options such as fruit and vegetables following one hour of running at speed, according to research published today in the American Journal of Clinical Nutrition. fMRI scans were used to chart appetite responses in the brain, in the study lead by scientists from the University of Aberdeen's Rowett Institute of Nutrition and Health. Dr Daniel Crabtree from the University of Aberdeen's Rowett Institute of Nutrition and Health said: "The key aim of our research was to examine the brain's responses to high and low calorie food following a period of acute exercise. "After running the volunteer's feelings of hu...
*  Appetite during Treatment | Oncolink - Cancer Resources
Appetite during Treatment. Oncolink - Cancer Resources. Cancer Types. Cancer Types. Bone Cancers. Breast Cancer. Head and Neck Cancers. Leukemia. Lung Cancers. Metastatic Cancer. Pediatric Cancers. Skin Cancers. Cancer Treatment. Getting Treatment. Cancer Resources. Appetite during Treatment OncoLink Last Modified: June 8, 2012. Appetite and oral intake can be improved by good side effect management so it is important to discuss your side effects with your care team so that the management can be adequate. Keywords Click on any of these terms for more related articles head neck appetite treatment. Metformin Linked to Lower Risk of Head, Neck Cancer Oct 5, 2015 Diabetes patients treated with the drug less likely to develop oropharyngeal, nasopharyngeal cancers. Appetite during Treatment Treatment for Primary rhabdoid tumors of the head and neck Swelling of the mucous-lining of the head and neck after treatment for epiglottic cancer Nutritional Status Druring Treatment for Head and Neck Cancer Eating after Treat...
*  tramadol and loss of appetite - MedHelp
... People. Full Site. Tramadol and loss of appetite. Read More. Read More. I have not seen the loss of appetite or weight loss others above have discussed and I would never take a pain medication for weight loss unless under the care of a doctor who specifically prescribed this for weight loss. Read More. Read More. Hi and sorry you are having this pain. I was on tramadol for about 2 months for back pain. Read More. Read More. I did tell myself this morning I had had a day of no pills for the first time in 5 years. How would it hurt me to take 2 or 3 tramadol on the worst days say like the next 2 days. Read More. Read More. We come from different parts of the world on the Tramadol support site....many, of course, in the US and UK. I have never had any side affects from Ultram except the loss of appetite. To me, that is a good thing as it helps me lose weight.but what do you do if you still have the pain. listen to music, read inspirational quotes to get you thru b/c where I am sitting now was worth 5 days o...
*  Appetite - Decreased - News, Information on Appetite - Decreased - NY Times Health Information
... Home Page Today's Paper Video Most Popular Times Topics. Health Guide. Health Research Fitness Nutrition Money Policy Views Health Guide. Search Health 3,000+ Topics. Health. Times Health Guide. Appetite - Decreased. News & Features. Appetite - Decreased. Weight Loss - Unintentional. News Features. November 6, 2007, Tuesday - By JANE E. Many Diagnoses of Depression May Be Misguided, Study Says. PERSONAL HEALTH. August 09, 2005, Tuesday - By Jane E. Brody - Health&Fitness - 1230 Words. PERSONAL HEALTH. June 07, 2005, Tuesday - By JANE E. BRODY - Health & Fitness - 1148 Words. Study Finds Appetites Reduced By Hormone. August 13, 2002, Tuesday - By SARA IVRY - Health & Fitness - 1134 Words. May 23, 2002, Thursday - By DENISE GRADY - National Desk - 1341 Words. Scientists say they may have found out why people get hungry at mealtime, why dieters who lose weight often gain it back and why a certain type of stomach surgery helps severely obese people lose a great deal of weight. Think Like a Doctor: Dazed and ...
*  Evaluation of a classroom-based physical activity promoting programme - ResearchGate
Impact Factor: 8. The information on energy expenditure and duration of physical activity was collected by a validated 7-day physical activity questionnaire. Energy expenditure and intensity of each Happy 10 session were measured by a physical activity monitor. The average energy expenditure and duration of total physical activity per day among students in the intervention school increased significantly from 15.0 to 18.2 kcal kg -1 and 2.8 to 3.3 h, respectively, whereas the figures significantly decreased in the control school. Both nutrition education special developed carton style nutrition education handbook and physical activity intervention Happy 10 program will be applied in all intervention schools of 5 cities except Beijing. In Beijing, nutrition education intervention will be applied in 3 schools and physical activity intervention among another 3 schools. Present study is the first and biggest multi-center comprehensive childhood obesity intervention study in China. The effect of duration of exercis...
*  Parents can help heavy kids with hearty appetites | Journal and Courier |
Parents can help heavy kids with hearty appetites. Journal and Courier. CLASSIFIEDS. JOBS. CARS. HOMES. APARTMENTS. AUCTIONS. SHOPPING. Hi,. My account. Newsletters. Log out. Log in. Subscribe. Activate. E-Newspaper. News. Purdue. Opinion. Sports. Life. Data. Obituaries. TOP HEADLINES. TOP HEADLINES. TOP HEADLINES. TOP HEADLINES. TOP HEADLINES. FEATURED:. Fowler House tour. Celebrations. Lafayette Magazine. Sheriff Sales. Search Search in News Archives Local Deals Yellow Pages. Parents can help heavy kids with hearty appetites. Feb. 17, 2014. Comments. Print. A A Parents need to help their young children control their appetite. / Digital Vision. Getty Images. by Nanci Hellmich, USA TODAY. by Nanci Hellmich, USA TODAY. Filed Under. USA Today news. USA Today nation. . ADVERTISEMENT. Some kids may have heartier appetites than others due to genetic differences, according to two new British studies, and U.S. nutrition experts say helping young children get a handle on their appetites early in life ma...
*  Parents can help heavy kids with hearty appetites | Palladium-Item |
Parents can help heavy kids with hearty appetites. Palladium-Item. CLASSIFIEDS:. JOBS. CARS. HOMES. APARTMENTS. SHOPPING. AUCTIONS. News. Sports. Life. Obituaries. Opinion. USA Today. LATEST HEADLINES. LATEST HEADLINES. LATEST HEADLINES. LATEST HEADLINES. LATEST HEADLINES. FEATURED:. Twitter. Facebook. E-mail. DealChicken. Search Search in News Archives Local Deals Yellow Pages. Parents can help heavy kids with hearty appetites. Feb. 17, 2014. Comments. Print. A A Parents need to help their young children control their appetite. / Digital Vision. Getty Images. by Nanci Hellmich, USA TODAY. by Nanci Hellmich, USA TODAY. Filed Under. USA Today news. USA Today nation. . ADVERTISEMENT. Some kids may have heartier appetites than others due to genetic differences, according to two new British studies, and U.S. nutrition experts say helping young children get a handle on their appetites early in life may be important in preventing obesity. One study, conducted in Great Britain, assessed babies' appetit...
*  12 Healthy Ways to Curb Your Appetite. ~ Joyce Del Rosario | elephant journal
12 Healthy Ways to Curb Your Appetite. ~ Joyce Del Rosario. elephant journal. Waylon. Elephant Journal. JOIN Twitter Facebook Google+ Submit Gift. Wellness. Food. 12 Healthy Ways to Curb Your Appetite. ~ Joyce Del Rosario. Via elephant journal on Apr 5, 2013. Here are twelve healthy ways to curb your appetite, kill those cravings and keep your diet on track:. Green tea is great for two reasons; firstly, it helps your body burn fat, and secondly, it helps you to ride out cravings because it causes your body to release a hormone called cholecystokinin, which is known to suppress the appetite. A study published in the European Journal of Nutrition found that adding chili to your meals can reduce your appetite and help you to eat less. Like elephant health wellness on Facebook. Daily Wake-Up Call Newsletter Get elephant's Daily Wake Up Call: a gap for inspiration meaning in the inbox of your mind. Email us please put title in subject bar of email so we'll be able to fix. {Waylon H. Lewis C Enterprises 2015: Use R...
*  Post Punk Kitchen Forum • View topic - Hearty Vegan Meals for Monster Appetites
Post Punk Kitchen Forum View topic - Hearty Vegan Meals for Monster Appetites. Post Punk Kitchen Forum. Register. FAQ. Search. Login It is currently Tue Oct 06, 2015 5:56 pm View unanswered posts. View active topics Board index. The Kitchen. Cookbooks All times are UTC - 6 hours. Hearty Vegan Meals for Monster Appetites. Page 3 of 6. Go to page Previous 1, 2, 3, 4, 5, 6 Next. Print view Previous topic. Next topic. Author Message kdub Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Fri Oct 28, 2011 8:37 am. Drinks Wild Tofurkey. Joined: Sun Nov 07, 2010 7:06 pm Posts: 2945 Location: Mke-ish I've never heard of/seen this book, but these recipes look amazing. *kdub's blog*. Top. jdfunks Post subject: Re: Hearty Vegan Meals for Monster Appetites Posted: Fri Oct 28, 2011 10:46 am. Vegan Vegan Vegan Vegan Vegan. Joined: Wed Oct 20, 2010 2:18 pm Posts: 4409 Location: Portland, OR I am so overwhelmed by this book, in such a good way. I'm going to spend some quality tim...
*  Satiety - Appetite Control
... Overview / Home Page Basic Health Multi Vitamin Multi Mineral Anti-Aging Antioxidants Coenzyme Q10 Krill Oil Omega-3 Fish Oil Green Tea Lifespan Joint Health Lubricate Joints Cartilage Support Cushion Joints Immune System - Avemar Inflammation Metabolic Energy Cardio Health Cholesterol / Lipid Levels Blood Pressure Homocysteine Skin Care Psoria-Gold Vision Lutein Zeaxanthin Weight Loss Satiety. Satiety - Appetite Control. 15, 22-27 Studies of normal-weight and obese subjects have shown that GLP-1 and CCK reduce feelings of hunger and decrease voluntary food intake at meals. 28-31 Recent findings demonstrate that pinolic acid, a polyunsaturated fatty acid derived from pine nuts, stimulates the secretion of the hunger-suppressing hormones CCK and GLP-1.7 This exciting finding suggests that pinolenic acid may have powerful effects in reducing appetite and increasing food satisfaction and fullness. 7 The researchers discovered that the pine nut extract stimulates production of the two important hunger suppre...
*  Compound That Switches Off Appetite In Mice Discovered By Hopkins Scientists
... Johns Hopkins scientists have produced a compound capable of rapidly turning off appetite in mice and causing weight loss similar in many ways to that achieved by fasting. "We are not claiming to have found the fabled weight-loss drug," says pathologist/biochemist Frank Kuhajda, M.D., spokesperson and research team member. Scientists normally look for the cascade of reactions, used to synthesize molecules called fatty acids, in the body's fat or liver tissue. Yet not only is the pathway found in certain brain cells, but these cells are concentrated in areas known to control appetite. Loftus, Ph.D., a team member. Scientists have long known that a hormone called neuropeptide Y NPY , located in the appetite centers in the brain's hypothalamus, is a major appetite regulator. In the study, the researchers injected mice with a single dose of C75, then observed them for changes in behavior, weight or body chemistry. But the C75-treated mice lost far more weight than their untreated, fasting brothers in the stu...
*  Appetite Issues Resolved with Superior Hardcore Peptides
... Register. Help. . Forum. Today's Posts. FAQ. Calendar. Forum Actions. Mark Forums Read. Quick Links. View Forum Leaders. Who's Online. What's New. Articles. Blog. Newsletter. Social Media. IronMag FB Group. Facebook. Twitter. YouTube. Instagram. Store. IronMag Labs. Research Chems. Advanced Search. Forum. Anabolic Forums. Anabolic Zone. Appetite Issues Resolved with Superior Hardcore Peptides. . If this is your first visit, be sure to check out the FAQ by clicking the link above. You may have to register before you can post: click the register link above to proceed. To start viewing messages, select the forum that you want to visit from the selection below. Appetite Issues Resolved with Superior Hardcore Peptides. Results 1 to 17 of 17. Thread: Appetite Issues Resolved with Superior Hardcore Peptides. Thread Tools Show Printable Version. Display Linear Mode. Switch to Hybrid Mode. Switch to Threaded Mode. 05-16-2014, 04:54 AM. #1. Mike Arnold. View Profile. View Forum Posts. . Moderator. MODERATOR. Join ...
*  Nausea, Vomiting and Appetite Loss -
... Information Nausea, Vomiting and Appetite Loss Part of A Practical Guide to HIV Drug Side Effects By Lark Lands 2013. Do you end up skipping doses of your antiretroviral drugs or other medications because you feel too nauseated to take them. Advertisement While medications can cause nausea, vomiting or appetite loss, there are other things that can also cause these symptoms. Your doctor should run blood tests and carry out an overall medical workup to see if liver problems, infections, hormone deficiencies or other medical conditions are contributing to your nausea or appetite loss. Not all doctors approach the problems of nausea, vomiting and appetite loss aggressively. Antiretroviral Drugs, Other Medications and Supplements Nausea is a common side effect of antiretroviral drugs, pain medications, cancer chemotherapies, radiation and many other therapies. See the section in Less Common Side Effects for more information. Drugs used to treat many infections can cause nausea. Pharmacists advise people to w...
*  Eat Fiber - The Science of Appetite - TIME
... MY ACCOUNT SIGN IN SIGN OUT SUBSCRIBE. Home. U.S. Politics. World. Business. Tech. Health. Science. Entertainment. Newsfeed. Living. Sports. History. The TIME Vault. Magazine. Ideas. Parents. TIME Labs. Money. LIFE. The Daily Cut. Photography. Videos. . Next Generation Leaders The 100 Most Influential People Ask the Expert Know Right Now New Adventurers Person of the Year 2014 Pittsburgh: The Comeback Question Everything Shaping Our Future Solutions That Matter TIME Explains Top 10 Everything of 2014 Top of the World Wonders of the World A Year In Space. Subscribe Newsletters Feedback Privacy Policy Your California Privacy Rights Terms of Use Ad Choices. RSS TIME Apps TIME for Kids Advertising Reprints and Permissions Site Map Help Customer Service. 2015 Time Inc. All rights reserved. Subscribe. Sign In Subscribe. The Science of Appetite. How to Curb Your Appetite. The Big Three. More Stories. Nature prefers you fat, but you can take control. New research could explain better approaches to diet...,28804,1626795_1626675_1626573,00.html
*  .. Stimulating Our Appetites .. Post navigation
post navigation previous next stimulating our appetites posted on january by mya food magazines and advertisers know it looking at mouthwatering images of foods often triggers the urge to eat blame that craving on a hormone suggests a new study featured in yesterdayâ s issue of cancer research update the study looked at a hormone that has received a lot of attention lately in obesity science circles ghrelin the hormone is recognized for stimulating our appetite ghrelin levels increase before meals and decrease afterwards circulating ghrelin then travels to receptors in the hypothalamus that are involved in appetite regulation this study collected ghrelin blood levels from men every or minutes from before breakfast until after lunch during two sessions between meals the well fed participants looked at images of tantalizing foods during one session a week later at the next session the men looked at images of everyday non food objects like a p...
*  Vital Wisdom: Insulin Reduces Appetite
... Vital Wisdom. Insulin Reduces Appetite. "Brain insulin may act as a satiety signal during the postprandial period and is associated with decreased appetite and reduced intake of highly palatable food, according to a study published online Feb. "Considering that the rewarding effect of palatable food overriding the homeostatic control of energy intake may promote obesity, insulin's potential to curb the appetite for hedonically salient, calorie-rich food deserves particular attention." This study suggests that building meals around low-energy density foods that significantly raise insulin levels, such as potatoes, rice, and the like, could curb appetite for highly palatable snacks. Don Matesz. Share to Facebook. Renaud and Will, Yes, I think the study cited by Renaud only demonstrated that fats decrease insulin sensitivity. At one time I used this blog to explore and support the theory and practice of modernized, flesh-based paleo and low-carb diets. Now I use it to explore and present the evidence and va...
*  Post Punk Kitchen Forum • View topic - Appetite for Reduction
Post Punk Kitchen Forum View topic - Appetite for Reduction. Post Punk Kitchen Forum. Register. FAQ. Search. Login It is currently Tue Oct 06, 2015 5:34 am View unanswered posts. View active topics Board index. The Kitchen. Cookbooks All times are UTC - 6 hours. Appetite for Reduction. Page 104 of 126. Go to page Previous 1 ... 101, 102, 103, 104, 105, 106, 107 ... 126 Next. Print view Previous topic. Next topic. Author Message annasrobbie Post subject: Re: Appetite for Reduction Posted: Mon Feb 04, 2013 10:04 am. Saggy Butt. Joined: Thu Sep 15, 2011 8:18 pm Posts: 1166 So my sister made the brocolli chowder and declared it a great success even though she DID sprinkle cheese all over it. I made the split pea soup. I thought it was good but SOOO salty. I think it must be my bullion making everything salty - instead of veggie broth I have been using the Better then Bullion stuff and I need to cut that out because it is just too much. The smoked paprika really does give a nice smokey flavor to the so...
*  Vitamin C appetite? light headed? -
Vitamin C appetite. light headed. - Skip to content. Search Advanced search. Quick links. Unanswered posts. Active topics. Search. The team. FAQ. Login. Register. Board index. General Vitamin C. Toxicity. Search. Vitamin C appetite. light headed. Any adverse effects of replacement vitamin C will be discuseed here. Topics include kidney stones, gall stones, oxidation, etc. We plan to move good discussions from the General Topics forum here for posterity. Moderator: ofonorow. Locked. Print view. Search Advanced search. 8 posts Page 1 of 1. NiacinVC. Enthusiast Posts: 141. Joined: Thu Dec 29, 2011 2:24 pm Location: Los Angeles, CA. Vitamin C appetite. light headed. Quote. Post Number: #1 Post by NiacinVC. Mon Jan 09, 2012 6:37 pm I have noticed I get light headed and hit with fatigue lately. At first I thought it was from megadosing VC but this has just started happening the last couple days. So I go eat and drink gatorade and feel instantly better. I think what is happening is that Vitamin C is curbing my appet...
*  Caltech scientists discover neurons that inhibit appetite
... Home. Sports. Lifestyle. Business. Community. Education. Opinion. CLICK TO WIN. Arts Culture. Health. Lifestyle. Health. Caltech scientists discover neurons that inhibit appetite. Caltech scientists discover neurons that inhibit appetite. Published on Thursday, 31 July 2014 20:38 Written by LAWT News Service. July 31, 2014 City News Service A Caltech professor has identified neurons in the brains of mice that control their appetite and eating behavior, a development that may provide new targets for therapeutic interventions to treat obesity, anorexia or other disorders in humans, the university announced recently. In research published in the journal Nature Neuroscience, David Anderson and his team used optogenetics, a technique that uses light to control neural activity to identify a subset of appetite-controlling neurons in a portion of a brain region called the amygdala. The amygdala is known to be important for processing emotional reactions. The neurons are located in the lateral subdivision of the ...
*  Foods that suppress your appetite | Health - Home
Foods that suppress your appetite. Health - Home. News. Local News. Odd News. Most Popular. Videos. Slideshows. Weather. Weather. Current Conditions. Interactive Radar. 7 Day Forecast. Detailed Forecast. Alerts. Map Room. Videocast. Entertainment. Entertainment. Health. On TV. Get Email Alerts. u local. Severe Weather. Health. Foods that suppress your appetite. Stuffed from eating too many holiday goodies. Dial down your appetite with these foods and eating habits known to suppress your appetite, according to Foods like beans, lentils, green bananas and cold potatoes yes, cold are rich in resistant starch, a carbohydrate that goes undigested and is stored in the large intestine. The process releases an acid that makes the body use stored fat for energy. They also keep you full for about an hour after eating. Add a couple tablespoons of vinegar to a meal high in carbohydrates to thwart hunger between meals. The trick to feeling full while eating less is to make your brain think you ate a big mea...
*  .. Can Chewing Gum Help Control Your Appetite? — Health Check .. Best of WIBX 950 .. Recommend
Can Chewing Gum Help Control Your Appetite. — Health Check. By Kathy Landin December 5, 2011 10:55 AM. Share on Facebook. Share on Twitter. Jono Haysom, Flickr Smokers have a gum that helps them quit smoking, so it’s only fair that overeaters have a gum to help them quit eating. Thankfully, scientists are getting close to making a safe appetite suppressant gum a reality. Appetite suppressants aren’t new. There are plenty of drugs on the market that claim to reduce hunger. But those drugs stimulate amphetamines and carry huge health risks like high blood pressure and heart failure. Researchers at Syracuse University have been focusing their research on a human hormone hpYY, which is naturally released in a person’s intestines when she eats or exercises and travels to the brain where it helps regulate hunger. Studies have shown that injections of the hormone do suppress appetite and, in some cases, people consumed 30 percent fewer calories after an injection. The ultimate goal is a m...
*  Pet forum for dogs cats and humans - - drooling and loss appetite
... Pet forum for dogs cats and humans - - Kitten health. - - drooling and loss appetite. sophie13 March 18th, 2014 11:09 AM. drooling and loss appetite. my angora female cat, 1.5 years old, was drooling about 5 days ago. she also lose her appetite. 2 days later, I brought her to a vet and they found some inflammation on her gums. they said that probably the symptoms caused by the inflammation or maybe kidney problems. in addition, she always drooling if I give her vitamin gel or any oral drugs. they gave 0.1 cc im injection of dexamethasone and anti-hypersalivation, twice a day. They said I have to inject it for the next five days and if after it, she's still drooling, she has to undergo some blood test to precisely know if there's some kidney problem or not. But, I stop the injection on the 2nd day and till now I haven't given the injection. but from my amateur physica...
*  Appetite For Destruction Lyrics by N.W.A. | Album: The Best of N.W.A.: The Strength of Street Knowle
Cuz it's on part of slung Relate this to no choice And listen to this straight-up man before they ban the voice While I ride to the rythem of a pop Remember the first nigga that runs is the first to get shot Whoever thinks that what I say and betray is negativity Need to come kick it in the city with me And find the black and crack de fact And take that shit back cuz they don't wanna fuck with that There's too many niggaz they're tryin to calm If mothafuckaz could get it, nobody wouldve fuck with it Appetite for destruction - For him to get a bit more shit he gotta commit - Murder in the first degree - a man slaughter Takin a life of his wife and young doughter A whole city of bitches they look sucked up And the niggaz iz killin it's straight fucked up Whoever sayin what Im sayinz for greed The 9 even when they're tryin to feed my appetite for destruction. The appetite is tremendous So Im gonna spin this Drop up some violence because they ax me to end this Some trouble that I cought cuz I was noisy A nigga tr...
*  Exercise Curbs Appetite: Mechanism Uncovered
Exercise Curbs Appetite: Mechanism Uncovered. It also balances the body’s hunger and satiety, or feelings of fullness, and communicates those states to the big brain.” Gautam Naik The Wall Street Journal , January 25, 2011 Exercise Curbs Appetite: Mechanism Uncovered How. Your Gut Says I’m Full I wrote in Lean For Life that regular exercise helps our appetite control mechanism work better. We’ve long known that exercise helps control eating and fat gain, but we are only now learning precisely how it works. I’ll also relate some interesting facts from The Wall Street Journal about sensors in the gut that balance hunger and fullness. “In obese animals, exercise increased interleukin-6 and interleukin-10 protein levels in the hypothalamus, and these molecules were crucial for increasing the sensitivity of the most important hormones, insulin and leptin, which control appetite,” Carvalheira explained. Leptin signals satisfaction, while insulin signals that excess calories are available for storage. “Our study sho...
*  Marijuana-induced ‘munchies’ explained: Food cravings are rooted in heightened sense of smell,
Marijuana-induced munchies explained: Food cravings are rooted in heightened sense of smell, study finds. National Post. National Post. Health. Marijuana-induced munchies explained: Food cravings are rooted in heightened sense of smell, study finds. The munchies effect of marijuana depends on cannabinoid receptors. During the study, however, Marsicano and colleagues at Neurocentre Magendie in Bordeaux, France, discovered that it s the presence of these natural cannabinoids in the human nose, and their activation, which increases the amount of food eaten. They also discovered that the receptors activation by external cannabinoids, such as those found in marijuana or hashish, can further up the ante of appetite, and caused the mice to increase their fast-induced food intake. Researchers also note that cannabinoid receptors in the olfactory bulb are necessary to observe this behaviour occurring from external THC being ingested, and that the phenomenon known popularly as the munchies requires the activation of sa...
*  Work Out in the Morning to Curb Your Appetite Later in the Day
... Follow. Follow Lifehacker. Following Lifehacker. Lifehacker After Hours. Lifehacker 10. Gizmodo. Kotaku. Lifehacker. You can skip this ad in 5 seconds. Work Out in the Morning to Curb Your Appetite Later in the Day. 2 Alan Henry Filed to: Health. Exercise. Science. appetite. Food. workout. Brain hacks. Share to Kinja. It may not seem like it, but a morning workout may be the key to effectively managing your portions and curbing your appetite later in the day. One new study pointed out that a good morning workout reduces your motivation to eat, which may translate to you being less likely to hit the fridge and load up on food. The Brigham Young University study, published in the October edition of the journal Medicine Science in Sports Exercise, put normal-weight and overweight participants through a 45 minute exercise regimen every morning, and then showed them pictures of food, compared to people of the same weight who were shown the same pictures but didn't work out. The researchers measured their neur...
*  Work Out in the Morning to Curb Your Appetite Later in the Day
... Follow. Follow Lifehacker. Following Lifehacker. Lifehacker After Hours. Lifehacker 10. Deadspin. Gawker. Lifehacker. Work Out in the Morning to Curb Your Appetite Later in the Day. 2 Alan Henry Filed to: Health. Exercise. Science. appetite. Food. workout. Brain hacks. Share to Kinja. It may not seem like it, but a morning workout may be the key to effectively managing your portions and curbing your appetite later in the day. One new study pointed out that a good morning workout reduces your motivation to eat, which may translate to you being less likely to hit the fridge and load up on food. The Brigham Young University study, published in the October edition of the journal Medicine Science in Sports Exercise, put normal-weight and overweight participants through a 45 minute exercise regimen every morning, and then showed them pictures of food, compared to people of the same weight who were shown the same pictures but didn't work out. The researchers measured their neural activity when shown the food, a...
*  I am 6 weeks pregnant and have no appetite, is this normal? | BabyCenter
I am 6 weeks pregnant and have no appetite, is this normal?. BabyCenter. PRODUCTS & GEAR. Mom Answers. Getting Pregnant Pregnancy Baby Toddler Bathing & Grooming Toddler Childcare Feeding & Nutrition Sleep Potty Training Behavior Development Play & Toys On the Go Products Feeding Products Activities & Play Products Health & Safety Products Potty Training Products Toddler Care Products Toddler Rooms Preschooler Big Kid Children's Health You & Your Family. I am 6 weeks pregnant and have no appetite, is this normal?. Posted: 11/06/2007 by a BabyCenter Member. Answer this. Report question. Mom Answers. Sort by: best answers. most recent answers. 1 - 10 of 39 answers. I am 6 weeks pregnant with my second baby. I'm not sick or anything, just have no desire to eat. Report answer. Was this answer helpful. 9 out of 9 found this helpful. I too am 6 almost 7 weeks pregnant and I do not have an appetite at all. Report answer. Was this answer helpful. 6 out of 6 found this helpful. I am 7 weeks and am going thro...
*  Advice please re: 3 yr olds loss of appetite
... Pregnancy. Baby. Support. Chat. Forum. New Posts. Today's Posts. Mark Forums Read. Today's Posts. My Posts. Chat. Advice please re: 3 yr olds loss of appetite. + Reply to Thread. Thread: Advice please re: 3 yr olds loss of appetite Share. Lynda M 7. Member. Join Date Aug 2006 Posts 34. Advice please re: 3 yr olds loss of appetite Hi folks, Not sure if this is the right place to look for advice but I am so worried bout my little one. Temp is now normal but she still has this cough which I am told will go in time, I hope. Any advice will be most gratefully recieved and I thank you in advance for taking the time to help me out. Cheers Lynda X. Reply With Quote. julie b 46. Member. Join Date Jan 2007 Posts 504. Now my 1 year old has caught it was at emergency Drs yesterday morning and at 10pm last night, terrible cough and very high temp but they said its viral so only calpol, he has had a terrible night. Julie. Reply With Quote. Lynda M 7. Member. Join Date Aug 2006 Posts 34. Hi Julie Hi julie, My little on...
*  No appetite
... Subscribe to: POZ magazine Newsletters. Join POZ:. POZ Personals Sign In / Join. POZ 100. FORUMS. ABOUT HIV/AIDS. What is HIV/AIDS. Symptoms Opportunistic Infections OIs Newly Diagnosed Disclosing Your HIV Status Living With HIV The Big Treatment Questions Side Effects and Other Health Problems POZ Focus / Fact Sheets Finding a Doctor Finding Support Health Services Directory. NEWS. Newsfeed Treatment News POZ Exclusives Opinion Criminalization News Conference Coverage Global News World AIDS Day RSS Feeds. COMMUNITY. POZ Community Forums. Meds, Mind, Body Benefits. Nutrition HIV. No appetite. Forums Index. How Can I Prevent HIV. I Just Tested Poz Living With HIV Vivir con el VIH Someone I Care About Has HIV Long-Term Survivors Positive Women AIDS Activism In Memoriam. Meds, Mind, Body Benefits Questions About Treatment Side Effects Insurance, Benefits Programs HIV Mental Health HIV Lipodystrophy Metabolic Problems Nutrition HIV Research News Studies. Off Topic Forums Off Topic Forum Forums Gatherings. St...
*  M Maraki
... add edit you are here scientific experts greece harokopio university maraki m maraki research topics appetite regulation appetite energy intake affect cross over studies oxygen consumption energy metabolism exercise heart rate m maraki summary affiliation harokopio university country greece publications acute effects of a single exercise class on appetite energy intake and mood is there a time of day effect m maraki department of human nutrition university of glasgow yorkhill nhs trust glasgow g sj uk appetite detail information publications acute effects of a single exercise class on appetite energy intake and mood is there a time of day effect m maraki department of human nutrition university of glasgow yorkhill nhs trust glasgow g sj uk appetite however when this type of exercise was performed in the morning it was perceived to require more effort labome org all rights researved princeton new jersey usa last updated february...
*  A Ball of Confusion: What Is Your Appetite for Risk Appetite? | IFAC
a ball of confusion what is your appetite for risk appetite ifac your browser version is out of date and no longer supported please upgrade to one of our supported browser versions navigation search strengthening organizations advancing economies enhanced search function ifac boards gateway mosaic login register...
*  Underweight / VitaViva-Info
... Vitaviva-Info Healthproblems. About VitaViva-Info. Many elderly and some young people suffer from undernourishment or malnutrition making them too thin. Stress and emotional problems may also reduce appetite. Stress and emotional problems might reduce the appetite and cause weight loss, but this is most often seen in young girls in the form of anorexia. Smokers have a larger fat metabolism than non-smokers often leading to an increase in weight in the time after having stopped smoking; so quitting the cigarettes will be the first step for smokers who would like to gain weight. Children and underweight No child, regardless of age, needs large amounts of sugar, but small children need a fat rich diet. Recommendations General advice on disease prevention and a healthy lifestyle can be found in the library article " General Advice - both for the healthy and the sick " You can gain weight without eating unhealthy food. People who want to lose weight by keeping their metabolism high should eat three main meals...
*  News | Optimum Nutrition: True Strength
News. Optimum Nutrition: True Strength. Where To Sample ON This Weekend. Jump Squats For Sport Performance. Power Test For Track Field. How The Brain Breaks Down Fat. What Finals Week Does To Diet. Where To Sample ON This Weekend. Eat More Of This To Lose Weight. Team Sports Sprint Training Tip. Guess Which Fruit Kids Like Most. Bench Press Power Training Tip. Photos from the 2015 Olympia. Where To Sample ON This Weekend. The Power Of Whole Grains. Aminos Caffeine Beat The Heat. US RETAILER LOCATOR. SHIPPING RETURNS. TERMS OF USE. HOME NEWS Mulitvitamin Appetite Suppressant. You're most likely aware that certain macronutrients can help keep you feeling full longer. The fiber in whole grains oats is one good example. That's important, since many scientists count satiety as a crucial component of weight loss and weight management. Who knew that multivitamins were a diet tool. Researchers from Laval University in Quebec had a group of healthy normal weight and obese subjects restrict energy intake for 15 weeks. ...
*  Healthy Minute: New study: A natural way to curb appetite - News - The Daily Ardmoreite - Ardmore,
... OK. site Archive. e-edition. subscribe. find and save. newsletter. classifieds. jobs. cars. FEATURED. NEWS NOW. What's Happening ... 5 things to do this week ... Watch where you are weaving ... What's Happening ... 5 things to do this week ... Watch where you are weaving ... Healthy Minute: New study: A natural way to curb appetite reports exercise reduces people s motivation to eat. According to a small new study 45 minutes of brisk walking lowers the brain s response to food that day, regardless of a person s body weight. Comment. The Daily Ardmoreite. Writer. Posted Oct. 9, 2012 at 11:00 AM. Posted Oct. 9, 2012 at 11:00 AM. reports exercise reduces people s motivation to eat. According to a small new study 45 minutes of brisk walking lowers the brain s response to food that day, regardless of a person s body weight. This study provides evidence that exercise not only affects energy output, but it also may affect how people respond to food cues, said Brigham Young ...
*  Scientists highlight link between stress and appetite
... Peer Reviewed News for Medical Professionals. Medical Research. Health. Special Topics. World. Home. Health. Aging. Asian Health. Events. Fitness. Food Nutrition. Happiness. Men's Health. Mental Health. Occupational Health. Parenting. Public Health. Sleep Hygiene. Women's Health. Healthcare. Africa. Australia. Canada Healthcare. China Healthcare. India Healthcare. New Zealand. South Africa. UK. USA. World Healthcare. Latest Research. Aging. Alternative Medicine. Anaethesia. Biochemistry. Biotechnology. Cancer. Cardiology. Clinical Trials. Cytology. Dental. Dermatology. Embryology. Endocrinology. ENT. Environment. Epidemiology. Gastroenterology. Genetics. Gynaecology. Haematology. Immunology. Infectious Diseases. Medicine. Metabolism. Microbiology. Musculoskeletal. Nephrology. Neurosciences. Obstetrics. Ophthalmology. Orthopedics. Paediatrics. Pathology. Pharmacology. Physiology. Physiotherapy. Psychiatry. Radiology. Rheumatology. Sports Medicine. Surgery. Toxicology. Urology. Medical News. Awards Prizes....
*  24-Day Challenge®
Companion Products Add an edge to your challenge and target your specific needs with Catalyst, ThermoPlus, Carb-Ease Plus, and the AdvoCare Workout Series.* Read more. There's something for everyone whether you are looking for weight management, energy, overall body composition or overall wellness. Herbal Cleanse System The AdvoCare Herbal Cleanse system can help rid your body of waste and prepare the body for optimal nutrient absorption with its unique blend of herbal ingredients.* Using a systematic approach, this 10-day system guides you through the daily steps for thorough internal cleansing and improved digestion.* Each Herbal Cleanse box includes these two key products: ProBiotic Restore capsules and Herbal Cleanse tablets. During this phase you will take three products that work together to provide you with sustained energy, appetite control, core nutrition and overall wellness.* Upon completion of the 24-Day Challenge, these products can continue to be taken every day as part of a healthy lifestyle. D...
*  Disinterest in food - CafeMom
CafeMom Groups. Active Posts in All Groups. Most Liked Posts. Posts With Most Replies. Featured Posts. Active Groups. Talk to other moms, share advice, and have fun. Join for Free. Weight Loss, Fitness & Health. Weight Loss, Fitness & Health Forums See Active Posts - Let's Talk. I don't know what's wrong with me but this past week I have lost interest in good nothing seems appealing to me anymore I still get hungry, not very often, and find something to eat maybe I'm getting sick dont know. Believe me I know that when you eat less its really bad for losing weight and for your metabolism and I love food, so this sucks just wondering if anyone else has ever felt like this Posted on the NEW CafeMom Mobile. Replies 11-20 :. 11-20 of 20 replies. 1, 2013 at 9:56 PM. But yeah, I noticed when I start eating right, I feel like I don't have much appetite. it makes it hard to get in my required calories so I don't screw up my metabolism. Quoting cowgirlmama: Cutting out majority of carbs from processed stuff, and gettin...
*  Calcium burns fat and helps control appetite - Nutrition Express Articles
Order 1-800-338-7979 24-hrs. Article Index > Authors > Newsletter Editor > December 2012 Calcium burns fat and helps control appetite by Newsletter Editor When dieters take in fewer calories than they burn, calcium supplements may stimulate fat loss, but prior studies have been inconclusive, doctors said. In one review, researchers analyzed eight placebo-controlled calcium weight-loss studies and found that dieters who got high levels of calcium increased fat metabolism by 11 percent compared to placebo. Those who consumed low levels of calcium before the study—less than 700 mg per day—saw the most fat-loss benefit. Researchers said the higher rate of fat-burning was equal to losing eight pounds per year. In discussing their findings, doctors said that calcium supplements raised the metabolic rate as effectively as caffeine. The average amount of calcium linked with the largest weight-loss benefit was 958 mg of calcium per day. Doctors also said good calcium levels help control appetite. Reference: Obes Rev; ... index/newsletters/december 2012/showarticle.aspx?id=1768
*  Episode 818 - An Appetite for Battle!
Episode 818 - An Appetite for Battle. . . . Kanto Battle Frontier Saga. The Sinnoh Saga. . . . . General Information MangaDex Character BIOs Detailed BIOs Chapter Guides Volume Guides RBG Series Yellow Series GSC Series RS Series FRLG Series Emerald Series DP Series Platinum Series HGSS Series BW Series B2W2 Series XY Series ORAS Series. . Lucario and the Mystery of Mew. . The Rise of Darkrai. Giratina & The Sky Warrior. Arceus and the Jewel of Life Zoroark - Master of Illusions Black: Victini & Reshiram White: Victini & Zekrom Kyurem VS The Sword of Justice -Meloetta's Midnight Serenade Genesect and the Legend Awakened Diancie & The Cocoon of Destruction Hoopa & The Clash of Ages. Pikachu's Summer Vacation Pikachu's Rescue Adventure Pikachu And Pichu Pikachu's PikaBoo Camp Pikachu. Gotta Dance!. Pikachu's Summer Festival. Pikachu's Ghost Festival. Pikachu's Island Adventure. Pikachu's Exploration Club Pikachu's Great Ice Adventure Pikachu's Sparkling Search Pikachu's Really Mysterious Adventure Eevee & Frien...
*  human biology - Eating rarely but a lot, or often but little - Biology Stack Exchange
... current community. chat blog. Biology. . Biology Meta. your communities. Sign up or log in to customize your list. more stack exchange communities. Stack Exchange. Inbox. Reputation and Badges. sign up log in tour. help. Tour Start here for a quick overview of the site. Help Center Detailed answers to any questions you might have. Meta Discuss the workings and policies of this site. Biology Questions. Tags. Users. Badges. Unanswered. Ask Question. Sign up. Biology Stack Exchange is a question and answer site for biology researchers, academics, and students. It's 100% free, no registration required. Eating rarely but a lot, or often but little. up vote 2 down vote favorite 1. I wonder if it matters if an average person eats the same amount of food distributed between a few 2-3 meals during the day, or constantly having small snacks. I'm interested in several aspects of such food consumption:. How does it affect appetite. How does it affect fat accumulation. Are there any notable side effects caused by...
*  Recent Articles | Study Participants And Neuroscience | The Scientist Magazine®| Page 19
Recent Articles. Study Participants And Neuroscience. The Scientist Magazine. Page 19. The Scientist Sign In or Register. Advertisement. PerkinElmer. The Scientist. tags: study participants x. neuroscience x. The Scientist study participants and neuroscience. Most Recent Capsule Reviews By Bob Grant. May 1, 2014. Madness and Memory, Promoting the Planck Club, The Carnivore Wa y, and The Tale of the Dueling Neurosurgeons 0 Comments. Contributors By Rina Shaikh-Lesko and Jef Akst. May 1, 2014. Meet some of the people featured in the May 2014 issue of The Scientist 0 Comments. Fuel Gauge By Anna Azvolinsky. May 1, 2014. An optical reporter quantitatively measures the ATP demands of presynaptic neurons. 2 Comments. Long-Distance Call By Rina Shaikh-Lesko. May 1, 2014. Neurons may use interferon signals transmitted over great distances to fend off viral infection. 0 Comments. Psychiatry: An SOS Call By Robert E. Becker. May 1, 2014. Social policies shaped the practice of psychiatry in the past. As the discipline b...,11/tags/study-participants,neuroscience/pageNo/19/
*  Recent Articles | Optimism And Neuroscience | The Scientist Magazine®| Page 19
Recent Articles. Optimism And Neuroscience. The Scientist Magazine. Page 19. The Scientist Sign In or Register. Advertisement. The Scientist. tags: optimism x. neuroscience x. The Scientist optimism and neuroscience. Most Recent Contributors By Rina Shaikh-Lesko and Jef Akst. May 1, 2014. Meet some of the people featured in the May 2014 issue of The Scientist 0 Comments. Fuel Gauge By Anna Azvolinsky. May 1, 2014. An optical reporter quantitatively measures the ATP demands of presynaptic neurons. 2 Comments. Long-Distance Call By Rina Shaikh-Lesko. May 1, 2014. Neurons may use interferon signals transmitted over great distances to fend off viral infection. 0 Comments. Psychiatry: An SOS Call By Robert E. Becker. May 1, 2014. Social policies shaped the practice of psychiatry in the past. As the discipline becomes ever more scientific, the effects of social policy on patient well-being must not be ignored. 0 Comments. The Crowd Takes On the Computer By Kerry Grens. May 1, 2014. Gangs of nonexperts are outperfor...,11/tags/optimism,neuroscience/pageNo/19/
*  Control Your Winter Appetite
... Cold, Flu Cough. Pain Management. WebMD Pain Coach Track your pain levels, triggers, and treatments. Sign up to receive WebMD's award-winning content delivered to your inbox. FDA Approves Diet Pill Belviq. FDA Delays Decision on Blood Thinner Eliquis WebMD Mobile Drug Information App Drug, supplement, and vitamin information on the go. Living Healthy. WebMD cuts through the hype to reveal the best kept secrets for healthy hair. Diet, Food Fitness Diet Weight Management. Food Recipes. Fitness Exercise Beauty, Balance Love Healthy Beauty. Featured Topics BMI Calculator: Get Personalized Results. Food Fitness Planner: Personalize Your Weight Loss Plan WebMD Allergy App for iPhone Fight allergies with daily forecasts, local alerts, and personalized tips. Family Pregnancy. Featured Topics Know the Signs of Early Pregnancy. Sign up to receive WebMD's award-winning content delivered to your inbox. WebMD Health Experts and Community. WebMD Communities Connect with people like you, and get expert guidance on livi...
*  .. What Our Customers are Saying .. Latest Stories .. What I Wish I Would Have Known… .. Mark Tha
Promotes a healthy appetite on a daily basis and during high stress times. Strengthens growth rate and muscle development Includes Amaferm, which improves the digestibility of feed, while bolstering overall health. “Sure Champ has always been a huge part of our feeding program. Sure Champ pellets and Vita Charge Stress Tubs have enabled our cattle to stay on feed and keep ...Read More. “We feed the meal version of Sure Champ® Pig from the time our pigs get to our barn until show day. We have tried several of the products, Vita Charge paste, Sure Champ pellets and Vita Charge Liquid Boost. They grow at a more consistent rate without the awkward growth spurts that sometimes ...Read More. "We always give our goats Vita Charge daily for the week leading up to and during the show. We rely heavily on Vita Charge during show season. We truly believe ...Read More. “At home, I know that we can depend on Sure Champ to keep our show lambs healthy and excited to eat. Since adding Vita Charge to our show day routin...
*  Mr. Brownstone
... Brownstone Cover =. Album = Appetite for Destruction. A-side = " It's So Easy " UK " Welcome to the Jungle " US. Released = June 15, 1987 Format =. Brownstone'" is a song by the American rock band Guns N' Roses, featured on their debut studio album, ' Appetite for Destruction ' 1987. Slash relates that the song was begun by him and Izzy Stradlin while they were at Izzy and his girlfriend Desi's apartment. I just keep trying to get a little better, said a little better than before"'. Slash. Brownstone was the first Guns N' Roses single in the United Kingdom, appearing as a double A-Side, alongside " It's So Easy ". This song exhibits the Bo-Diddley beat originally created by Bo Diddley. This beat is often-used in many rock songs starting from the 1960s. Brownstone" and contains lyrics from the song. Single Release Live References External links. Brownstone" was not released as a single worldwide like all the other singles from ' Appetite for Destruction '. It was released as a single only in the UK, but w...
*  Vomiting at Night? - October 2009 Babies -
Vomiting at Night. Vomiting at Night. Vomiting at Night. From: aggie0961. Posted: Jan-23 05:35 AM 1 of 6. Natalie has been throwing up at night for the past 4 days. I thought it was just a stomach bug since all 3 of us in the house had some symptoms over the past week....but this just seems odd. My mom only vomited once, and I never did. Natalie had diarrhea for a couple of days, and threw up at night one of those days. :- Natalie has been throwing up at night for the past 4 days. I thought it was just a stomach bug since all 3 of us in the house had some symptoms over the past week....but this just seems odd. My mom only vomited once, and I never did. Natalie had diarrhea for a couple of days, and threw up at night one of those days. After 4 days, Dorian stopped puking, but his appetite hasn't returned yet. Sure enough, if he drank a full cup of water he'd puke 10 minutes later but the little bit of pedialyte could be kept down. After 4 days, Dorian stopped puking, but his appetite hasn't returne...
*  .. Amaryl .. Like this: .. Related .. See Jane Twitter .. MD .. RN .. RT .. See EMS See ED .. See Y
Amaryl. IÂ remember this eccentric endocrine MD who when consulted on patients in the hospital for either high or low blood sugars. He would come in, look at the chart, see the patient on Amaryl, see the trend of blood sugars dropping below 50 and flip out in the nurses station about Amaryl and Kidney function and how patients with increased creatinine should not even be on Amaryl– in fact he was so adamant that NO patient in the hospital should be on Amaryl. There are just to many variables affecting the blood glucose of sick patients, especially decreased kidney function as we load many of the patients with antibiotics and lasix and CT scan dye not to mention the NPO status half of the time for testing. The bottom line is that I remembered and learned : No AMARYL for impaired renal function and extreme caution if the attending family doctor is ordering amaryl in any of my patients. internal medicine doctor admits patient 5 days ago to tele. Patient is taking the Amaryl. ooooooooops here we go….blood glucose...
*  Letra de Scandalous de T. Mills - MUSICA.COM
... Vídeos Musicales. Letras: 837.970. Vídeos Musicales: 4.765. MUSICA.COM. Scandalous. Más Música. :: Los mejores vídeos del momento. Letras Ví­deos Fotos Biografí­a Foro Fans Fondos Ranking. LETRA 'SCANDALOUS'. I got a girl but she ain't home, you want it huh. Just come on over. You ain't gotta go, she ain't gotta know. You want it huh, me too, now come on over. The light's down, the radio's on, playing my song, let me sing it for you. The tape's in, the camera's on, We gone be here till the morn, I got a thing for you. It ain't wrong if I make it feel right. I'ma have you my way, you can fill my appetite. You make me say.. Chorus x 2 You so scandalous you so you so scandalous You so scandalous but damn that pussy glamorous I dish it out you eat it up, no loving we just fucking, yeah, beat it up. The doors locked, the blinds are shut, Let me ask you what, I got a question for you. Let's go again I'm talkin round two we gone be here till the morn I got a thing for you. It ain't wrong if you make...
*  PLOS ONE: Measurement of Ad Libitum Food Intake, Physical Activity, and Sedentary Time in Response t
... o Overfeeding. Article-Level Metrics. View. Sum of PLOS and PubMed Central page views and downloads. Open Access Peer-reviewed Research Article. Measurement of Ad Libitum Food Intake, Physical Activity, and Sedentary Time in Response to Overfeeding. Published: May 22, 2012 DOI: 10.1371/journal.pone.0036225. Article. We hypothesized a down-regulation in subsequent food intake and sedentary time, and up-regulation in non-exercise activity and core temperature in response to overfeeding in order to maintain body weight constant. Following the 3 days of ad libitum food intake, volunteers resumed their weight maintaining diet for 3 days as a wash out period followed by another 3 days of either the WM or OF diet and once again followed by 3 days of ad libitum food intake using the vending machines. Following the 3 days of ad libitum food intake, volunteers resumed their weight maintaining diet for 3 days as a wash out period followed by another 3 days of either the WM or OF diet and once again followed by 3 day...
*  ARS Project: Dietary and Lifestyle Factors Affecting Food Intake and Energy Metabolism in Lean and O
... verweight Individuals 420907 Annual Report Food Components and Health Laboratory : Research. Page Banner. United States Department of Agriculture Agricultural Research Service. ARS Home. About ARS. Contact Us. Search for This. ARS Research. Research Home. National Programs. Research Projects. Scientific Manuscripts. International Programs. Trending Research Topics. Scientific Software/Models. Databases & Datasets. Scientific Collaborations. ARS People Locations. Find a person. Find a location. Find an office at headquarters. Organizational chart. Administrator’s Council. ARS Newsroom. News Home. Latest News. Magazine. Photos. Subscription Lists. Briefing Room. Podcasts. Events. Press Room. Video. ARS Careers. ARS Vacancies at USAJOBS. Careers at ARS Info. Post Doctoral Positions. . Site Map. A-Z Index. Help. . You are here: Northeast Area Home / Food Components and Health Laboratory / Research / Research Project #420907. Related Topics Project Team Rumpler, William. Project Annual Reports 2014. 2013. 2012...
*  Phytogenics
'Phytogenics' are a group of natural growth promoter s NGPs or non-antibiotic growth promoters used as feed additive s, derived from herbs, spices or other plants. They are commonly regarded as favorable alternatives to antibiotic growth promoters AGPs in livestock production. 1 Benefits of phytogenics Modes of action Effect on feed intake. Effect on gut microflora. Effect on growth rates. Effect on ammonia emissions. Production of Phytogenics References Further reading External links. Benefits of phytogenics. The potential benefits of using phytogenics in livestock nutrition are:. increased feed intake stimulation of digestion increased growth performance reduced incidence of diarrhea increased performance parameters improved reproductive parameters improved feed efficiency higher profitability. Modes of action. Effect on feed intake. Effect on gut microflora. A well-balanced gut microflora is necessary to protect the gut from pathogenic invasion. At the best, a beneficial combination of different phytogenic...
*  Normal food at will and nil-by-mouth enteral feeding after major upper GI surgery did not differ for
normal food at will and nil by mouth enteral feeding after major upper gi surgery did not differ for mortality or morbidity evidence based nursing... html?frame=header
*  nematocyst | biology |
. nematocyst. biology. Shop. School and Library Subscribers. JOIN. LOGIN. Activate Your Free Trial. Stories. quizzes. galleries. lists. Nematocyst. Biology. Read. View History. Edit. Feedback. Nematocyst, minute, elongated, or spherical capsule produced exclusively by members of the phylum Cnidaria e.g., jellyfish, corals, sea anemones. Several such capsules occur on the body surface. Each is produced by a special cell called a. cnidoblast and contains a coiled, hollow, usually barbed thread, which quickly turns outward i.e., is everted from the capsule upon proper stimulation. The purpose of the thread, which often contains poison, is to ward off enemies or to capture prey. When stimulated by chemical or mechanical cues, a lidlike structure on the top of the capsule pops aside, and the thread everts explosively with a twisting motion. As eversion and twisting proceed, the barbs act like a drill, penetrating into and pulling the thread into the foreign object. If a toxin is present, it passes ...
*  Structure of nematocysts isolated from the fire corals Millepora alcicornis and Millepora complanata
... Cnidaria: Hydrozoa. . . . Services on Demand. Article. English pdf. English epdf. Article in xml format. Article references. How to cite this article. Automatic translation. Send this article by e-mail. Indicators. Cited by SciELO. Access statistics. Related links. Cited by Google Similars in SciELO Similars in Google. uBio. Share. More. More. Permalink. Journal of Venomous Animals and Toxins including Tropical Diseases. On-line version ISSN 1678-9199. Abstract. GARCIA-ARREDONDO, A et al. Structure of nematocysts isolated from the fire corals Millepora alcicornis and Millepora complanata Cnidaria: Hydrozoa. J Venom. Anim. Toxins incl. Trop. Dis. 2012, vol.18, n.1, pp. 109-115. Structural characteristics of discharged and undischarged nematocysts from the hydrozoans Millepora alcicornis and Millepora complanata, two fire corals collected in the Mexican Caribbean, were examined using transmission electron, scanning and light microscopy. In this study, we report for the first time images of the nematocysts ...
*  Nanosecond-scale release of stinging jellyfish nematocysts | EurekAlert! Science News
Nanosecond-scale release of stinging jellyfish nematocysts. EurekAlert. Science News. News. Breaking News. Biology. Earth Science. Science Business News. EurekAlert!中文版. Marine Science. Breaking News. Science Business News. Biology. Earth Science. EurekAlert. Meetings. Marine Science In-depth investigations on all things marine science More. About EurekAlert. Help / FAQ. Public Release: 8-May-2006 Nanosecond-scale release of stinging jellyfish nematocysts. By using an electronic ultra-high-speed camera, researchers have characterized the explosive discharge of stinging jellyfish nematocytes and show that this event represents one of the fastest cellular processes in nature. The research is reported by Thomas Holstein of the University of Heidelberg and his colleagues in the May 9th issue of Current Biology. The researchers propose that the high speed of discharge is caused by the release of energy stored in the stretched configuration of the collagen-polymer of the nematocyst capsule wall. ### Timm N chter of...
*  Molecular Expressions: Science, Optics & You - Olympus MIC-D: Pond Life Digital Movie Gallery - Hydr
... a Coelenterata Movie #2. Visit the Molecular Expressions Website. Galleria. Photo Gallery. Silicon Zoo. Chip Shots. Screen Savers. Museum. Web Resources. Primer. Java Microscopy. Win Wallpaper. Mac Wallpaper. Publications. Custom Photos. Image Use. Contact Us. Search. Home. Pond Life Digital Movie Gallery Hydra Coelenterata Movie #2. In a phylum dominated by marine species as diverse as the jellyfishes and corals, the hydra class Hydrazoa are among the few commonly observed coelenterates in freshwater ecosystems. Skipping the medusa stage typical of the jellyfish, the stalked and tentacled invertebrate polyps can reproduce sexually or asexually. They follow the basic coelenterate radially symmetric body plan of two cell layers without a true body gut, having instead a gastrovascular cavity, with the mouth as a single opening. Hydra bear the name of the Greek mythological creature of Lerna, described as having the body of a hound and 100 serpentine heads, each bearing poisonous breath. With so hideous a vi...
*  Descriptions and articles about Edwardsia arctica - Encyclopedia of Life
... Edwardsia arctica mdash; Details. learn more about names for this taxon. Add to a collection Add a link Add an article. Overview Detail Data 7 Media 0 Maps Names Community Resources Literature Updates. Table of Contents. Overview. Comprehensive Description. Ecology. Habitat Dispersal. Resources. Partner links Literature. Literature references Biodiversity Heritage Library. Overview. Comprehensive Description. Biology: Nematocysts. Learn more about this article. More info Location Image Cnidae Type Range of Lengths m. Range of Widths m n N State Carlgren O., 1940. Column. N/A unspecified nematocysts 46 - 48 x 4.5 - 4.5 0 /. Column. N/A unspecified nematocysts 46 - 48 x 4.5 -. / Unfired. Tentacles. N/A spirocysts 1.5 - 27 x 5 - 5 0 /. N/A unspecified nematocysts 19 - 24 x 2.5 - 2.5 0 /. N/A unspecified nematocysts 19 - 24 x 2.5 -. / Unfired. Hexacorallians of the World. Source: Hexacorallians of the World. Trusted. Article rating from 0 people. Default rating: 2.5 of 5. comment on or rate this article. Eco...
*  Green light: India and China's carbon targets, biking bonanza and giant jellyfish | Environment | Th
Green light: India and China's carbon targets, biking bonanza and giant jellyfish. Environment. The Guardian. Close. Skip to main content. sign in. Saved for later Comment activity Edit profile Email preferences Change password Sign out. subscribe. search. jobs. more. from the guardian:. jobs. change edition:. switch to the UK edition. switch to the AU edition. switch to the INT beta edition. US edition. switch to the UK edition. switch to the Australia edition. switch to the International beta. The Guardian. home. › environment. climate change. wildlife. energy. pollution. home. US. world. opinion. sports. soccer. tech. arts. lifestyle. fashion. business. travel. environment selected. science. browse all sections close. Environment. Green light. Green light: India and China's targets, biking bonanza and giant jellyfish. This is a weekly email briefing from, bringing you the best news, analysis and debate. Sign up here to get the briefing delivered to your inbox. 400 Thousand Generat...
*  Senses ( Real World ) | Biology | CK-12 Foundation
Senses Real World. Biology. CK-12 Foundation meta http-equiv="refresh" content="1; url=/nojavascript/". iframe src="//" height="0" width="0" style="display:none;visibility:hidden" /iframe. Dismiss. See what's new this school year. Donate. Help. Join. Sign In. Dashboard. Groups. Library. Browse. Search. Help. Donate. Join. Sign In. You are viewing an older version of this Concept. Go to the latest version. Senses. . Animals that exhibit radial symmetry, tissues but no organs and possess stinging cells called nematocysts. 0 %. Progress. Practice Senses Practice. Progress. 0% Practice Now. Biology. Human Biology. ... ... All. 14. Read. 1. Video. 3. Activities. 1. Study Aids. 2. Assessments. 2. Web Links. 2. Real World. 3. More. All Modalities. Share to Groups. Add to Library. Share to Groups Customize. Details. Resources. Published. Stemming Disease Teacher Contributed. Parkinson's Disease. Topic Neurological Disorders Student Exploration A Way To A Cure Thanks to Mi...
*  Ice Hotel Guide - The Daily Meal
... Site Recipes Restaurants/Bars. Community. Healthy Eating. Restaurants. Drink. Where to Drink. Travel. Trip Tips. Healthy Eating. Healthy Kitchen. Best Recipes. Video. Trending Stories From Travel. Best Caribbean Getaway Restaurants. 10 Easy Casserole Recipes. Kid-friendly Halloween Treats. Best Halloween Towns. Halloween Treats. Healthy Coffee Sweeteners. Foods For Emergencies. The Daily Dish 10.2.15. Step-by-Step Guide to Spending a Night at a N ice Hotel The Daily Meal spends a frigid night at an ice hotel during Québec Winter Carnival 3.259615. Most popular Stories The One Food That Guy Fieri Won t Eat The One Food That Guy Fieri Won t Eat Best Cheeseburgers in America 6 Smelliest Cheeses Don’t Eat These Foods Raw. Girl Eat World: Meet the Woman Who Travels the World Eating Unique Foods in Every Country She Visits. The Daily Meal spent a night at Hôtel de Glace, a Québec ice hotel constructed anew each winter with 20,000 blocks of ice. Though ski vacations remain a popular winter retreat, vacations re...
*  BBQ Sauce Taste Test - The Daily Meal
... Site Recipes Restaurants/Bars. Community. Healthy Eating. Grilling Barbecue. Eat/Dine. Products. Drink. Where to Drink. The Ultimate Tailgate. Healthy Eating. Healthy Kitchen. Best Recipes. Halloween. Video. 54 Below Review. Best Caribbean Getaway Restaurants. 10 Easy Casserole Recipes. Kid-friendly Halloween Treats. Most popular Stories The One Food That Guy Fieri Won t Eat Mario Batali Calls Out the Pope America’s Best Burritos 2015 Eat Your Way to Healthy Skin 35 Chicken Recipes for Busy Weeknights. Barbecue sauce is one of those products that can make or break a summer cookout, and even when it's cold out there's nothing that can ruin a sandwich or burger quicker than the application of crummy barbecue sauce. When it comes to bottled barbecue sauces, one thing is for certain: all are not created equal. Some are too sweet, some are too spicy, some have that weird artificial smoke flavoring, and some just taste sort of 'off' and don’t hit that barbecue sauce sweet spot. To buy a bottle of each and go t...
*  Ginger-Turmeric Wings Recipe - The Daily Meal
... Site Recipes Restaurants/Bars. Join. Community. Cook. Quick Easy. Healthy Eating. Seasonal. Kitchen Tools. Restaurants. Drink. Where to Drink. Trip Tips. Hosting Tips. Healthy Eating. Healthy Kitchen. Weight-Loss. Best Recipes. Halloween. Video. 10 Regional Chili Recipes. Toast Recipes for Every Meal. The Perfect Fall Cheese Board. 54 Below Review. Delicious Healthy Smoothies. 5 Ways to Drink Iced Coffee. Best Caribbean Getaway Restaurants. Ingredients 1 tablespoon vegetable oil 2 cloves garlic, peeled Three ¼-inch-thick slices ginger, peeled 7 whole chicken wings, tips removed, separated at the joint 1 tablespoon turmeric 1 tablespoon ground coriander Salt and freshly ground white pepper, to taste. But instead of deep-frying the wings, I tried to make these a little healthier while still retaining all the flavor, so I pan-roasted them in the oven. And the telltale stains will be everywhere, no matter how hard you try to work clean. Combine the oil, garlic, and ginger in a 10-inch, ovenproof sauté pan an...
*  Teaching a Child Self-Feeding - HowStuffWorks
... Understanding a Child's Eating Habits by Alvin Eden, MD. Children's Eating Habits Overview. 2 Teaching a Child Self-Feeding. 3 Instilling Good Eating Habits in a Child. 4 Obesity and Children. The ability to place objects into his mouth is the first sign that your baby is getting ready to feed himself. Teaching a Child Self-Feeding. The Transitional Period At six months, your baby can put objects into her mouth. She can hold a small bottle by herself and may begin to take liquids from a cup with help. Finger foods appropriate for your child during this transitional period include those that dissolve easily in the mouth, such as the following: Small pieces of toast Small pieces of cooked vegetables, such as peas, squash, soft carrots, or broccoli Self-feeding is a major step for your baby. Small pieces of very soft meat, such as fish without bones, chicken without skin or bones, or hamburger Small pieces of ripe peaches, bananas, pears, or other soft fruit Small pieces of soft cheese, such as Monterey Jac...

Sensory-specific satiety: Sensory-specific satiety is a sensory hedonic phenomenon that refers to the declining satisfaction generated by the consumption of a certain type of food, and the consequent renewal in appetite resulting from the exposure to a new flavor or food.Raynor H, Epstein L.Specific appetite: Specific appetite, also known as specific hunger, is a drive to eat foods with specific flavors or other characteristics.PRX-07034: PRX-07034 is a selective 5-HT6 receptor antagonist. It has cognition and memory-enhancing properties and potently decreases food intake and body weight in rodents.Hunger (motivational state): Hunger is a sensationTransvestic fetishism: Transvestic fetishism is a psychiatric diagnosis applied to those who are thought to have an excessive sexual or erotic interest in cross-dressing; this interest is often expressed in autoerotic behavior. It differs from cross-dressing for entertainment or other purposes that do not involve sexual arousal, and is categorized as a paraphilia in the Diagnostic and Statistical Manual of the American Psychiatric Association.Songhwa milsuLaminaria digitata: Laminaria digitata is a large brown alga in the family Laminariaceae, also known by the common name Oarweed. It is found in the sublittoral zone of the northern Atlantic Ocean.List of puddings: This list includes both sweet and savoury puddings that conform to one of two definitions:CholecystokininLevofenfluramine: Levofenfluramine (INN), or (−)-3-trifluoromethyl-N-ethylamphetamine, also known as (−)-fenfluramine or (R)-fenfluramine, is a drug of the amphetamine family that, itself (i.e.Stigmatic-eligibilic paraphilia: Stigmatic-eligibilic paraphilias are desires whose objects "become eligible" to be desired because of, rather than despite, a stigma which they bear. The manifold manifestations of these paraphilias cover the broadest range of physical, intimate and social circumstance.Aphelandra: Aphelandra is a genus of about 170 species of flowering plants in the family Acanthaceae, native to tropical regions of the Americas.Stomach diseaseBanquet Foods: Banquet Foods is a subsidiary of ConAgra Foods that sells various food products, including frozen pre-made entrées, meals, and desserts.Hebephilia: Hebephilia is the strong and persistent adult sexual interest in pubescent (early adolescent) individuals, typically ages 11–14 (see the Tanner stage). It differs from ephebophilia, which is the strong and persistent sexual interest to those in later adolescence, approximately 15–19 years old, and differs from pedophilia, which is the primary or exclusive sexual attraction to prepubescent children.Information hypothesis of conditioned reinforcementPre-locus coeruleus: Pre-locus coeruleus is a small nucleus in the brainstem. This small cluster of neurons also is referred to by the abbreviation "pre-LC".Solitary nucleus: In the human brain, the solitary nucleus (nucleus of the solitary tract, nucleus solitarius, nucleus tractus solitarii, NTS) is a series of nuclei (clusters of nerve cell bodies) forming a vertical column of grey matter embedded in the medulla oblongata. Through the center of the NTS runs the solitary tract, a white bundle of nerve fibers, including fibers from the facial, glossopharyngeal and vagus nerves, that [the NTS.Artificial butter flavoring: Artificial butter flavoring may contain diacetyl, acetylpropionyl, or acetoin, three natural compounds in butter that contribute to its characteristic flavor. Because of this, manufacturers of margarines or similar oil-based products typically add diacetyl, acetylpropionyl and acetoin (along with beta carotene for the yellow color) to make the final product butter-flavored, because it would otherwise be relatively tasteless.DevazepideTiflorexFormicationGlucagon-like peptide-2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).Taste: Taste, gustatory perception, or gustationAdjectival form: [is the sensory impression of food] or other substances on the tongue and is one of the [[sense|five traditional senses.Cephalic phase: The cephalic phase of gastric secretion occurs even before food enters the stomach, especially while it is being eaten. It results from the sight, smell, thought, or taste of food, and the greater the appetite, the more intense is the stimulation.Olson's Extinction: Olson's Extinction was a mass extinction that occurred in the Early Guadalupian of the Permian period and which predated the Permian–Triassic extinction event.Rhombomere: In the vertebrate embryo, a rhombomere is a transiently divided segment of the developing neural tube, within the hindbrain region (a neuromere) in the area that will eventually become the rhombencephalon. The rhombomeres appear as a series of slightly constricted swellings in the neural tube, caudal to the cephalic flexure.PyrrolidineList of countries by food energy intake: Food consumption refers to the amount of food available for human consumption as estimated by the FAO Food Balance Sheets. However the actual food consumption may be lower than the quantity shown as food availability depending on the magnitude of wastage and losses of food in the household, e.Sodium pertechnetateDimethylacetamideReward system: The reward system is a group of neural structures that are critically involved in mediating the effects of reinforcement. A reward is an appetitive stimulus given to a human or some other animal to alter its behavior.Sports drink: Sports drinks are beverages whose stated purpose is to help athletes replace water, electrolytes, and energy after training or competition, though their efficacy for that purpose has been questioned, particularly after exercise which is only moderate.SpiradolineAnthopleurin: Anthopleurin is a toxin from the venom of the sea anemones Anthopleura xanthogrammica and Anthopleura elegantissima. These anemones use anthopleurin as a pheromone to quickly withdraw their tentacles in the presence of predators.Index of energy articles: This is an index of energy articles.Classification of obesity: Obesity is a medical condition in which excess body fat has accumulated to the extent that it has an adverse effect on health.WHO 2000 p.Nepean Hospital

(1/442) Correlation of regional cerebral blood flow and change of plasma sodium concentration during genesis and satiation of thirst.

Positron emission tomography studies were conducted during genesis of moderate thirst by rapid i.v. infusion of hypertonic saline (0.51 M) and after satiation of thirst by drinking water. The correlation of regional cerebral blood flow with the change in the plasma Na concentration showed a significant group of cerebral activations in the anterior cingulate region and also a site in the middle temporal gyrus and in the periaqueductal gray. Strongest deactivations occurred in the parahippocampal and frontal gyri. The data are consistent with an important role of the anterior cingulate in the genesis of thirst.  (+info)

(2/442) Effect of the glycemic index and content of indigestible carbohydrates of cereal-based breakfast meals on glucose tolerance at lunch in healthy subjects.

BACKGROUND: Diets with a low glycemic index (GI) have been shown to improve glucose tolerance in both healthy and diabetic subjects. Two potential mechanisms are discussed in relation to long-term metabolic effects: a decreased demand for insulin in the postprandial phase and formation of short-chain fatty acids from fermentation of indigestible carbohydrates in the colon. OBJECTIVE: The objective was to study the effect of the GI and the indigestible carbohydrate--resistant starch (RS) and dietary fiber (DF)--content of cereal-based breakfasts on glucose tolerance at a second meal (lunch) in healthy subjects. DESIGN: The effects of 7 test breakfasts with known GIs (GI: 52-99) and RS + DF contents (2-36 g) were evaluated. White-wheat bread was used as a reference breakfast (high GI, low RS + DF content). Glucose and insulin responses after the second meal were measured in healthy subjects. In addition, the satiating capacity of 4 of the 7 test breakfasts was estimated before and during the second meal. RESULTS: Two of the 4 low-GI breakfasts improved glucose tolerance at the second meal. Only these 2 breakfasts were capable of postponing the in-between-meal fasting state. There was no measurable effect of fermentable carbohydrates on glucose tolerance at the second meal. The highest satiety score was associated with the barley breakfast that had a low GI and a high RS + DF content. CONCLUSIONS: Glucose tolerance can improve in a single day. Slow absorption and digestion of starch from the breakfast meal, but not the content of indigestible carbohydrates in the breakfast meal, improved glucose tolerance at the second meal (lunch).  (+info)

(3/442) A rapid feedback signal is not always necessary for termination of a drinking bout.

When a pig is deprived of drinking water, a deficit of body water develops that is corrected when the pig drinks to satiation. If food is available during the deprivation, the stimulus to drinking is plasma hyperosmolality. Because of the delay in correction of plasma hyperosmolality as ingested water is slowly absorbed, it has been thought that a rapid inhibitory signal from the digestive tract is necessary to prevent overdrinking. This concept was tested by measuring changes in plasma osmolality before and during drinking after such deprivation and also after infusion of hypertonic saline. As drinking began, there was a rapid fall of plasma osmolality to levels insufficient to drive drinking by the time drinking ended. This fall of plasma hyperosmolality to subthreshold levels while the pig is drinking seems to make a rapid inhibitory control signal from the digestive tract unnecessary to terminate the drinking bout under these conditions.  (+info)

(4/442) Neuroanatomical correlates of hunger and satiation in humans using positron emission tomography.

The central role of the hypothalamus in the origination and/or processing of feeding-related stimuli may be modulated by the activity of other functional areas of the brain including the insular cortex (involved in enteroceptive monitoring) and the prefrontal cortex (involved in the inhibition of inappropriate response tendencies). Regional cerebral blood flow (rCBF), a marker of neuronal activity, was measured in 11 healthy, normal-weight men by using positron emission tomography in a state of hunger (after 36-h fast) and a state of satiation (after a liquid meal). Hunger was associated with significantly increased rCBF in the vicinity of the hypothalamus and insular cortex and in additional paralimbic and limbic areas (orbitofrontal cortex, anterior cingulate cortex, and parahippocampal and hippocampal formation), thalamus, caudate, precuneus, putamen, and cerebellum. Satiation was associated with increased rCBF in the vicinity of the ventromedial prefrontal cortex, dorsolateral prefrontal cortex, and inferior parietal lobule. Changes in plasma insulin concentrations in response to the meal were negatively correlated with changes in rCBF in the insular and orbitofrontal cortex. Changes in plasma free fatty acid concentrations in response to the meal were negatively correlated with changes in rCBF in the anterior cingulate and positively correlated with changes in rCBF in the dorsolateral prefrontal cortex. In conclusion, these findings raise the possibility that several regions of the brain participate in the regulation of hunger and satiation and that insulin and free fatty acids may be metabolic modulators of postprandial brain neuronal events. Although exploratory, the present study provides a foundation for investigating the human brain regions and cognitive operations that respond to nutritional stimuli.  (+info)

(5/442) Glucagon-like peptide-1 promotes satiety and reduces food intake in patients with diabetes mellitus type 2.

Glucagon-like peptide-1-(7-36) amide (GLP-1) is an incretin hormone of the enteroinsular axis. Recent experimental evidence in animals and healthy subjects suggests that GLP-1 has a role in controlling appetite and energy intake in humans. We have therefore examined in a double-blind, placebo-controlled, crossover study in 12 patients with diabetes type 2 the effect of intravenously infused GLP-1 on appetite sensations and energy intake. On 2 days, either saline or GLP-1 (1.5 pmol. kg-1. min-1) was given throughout the experiment. Visual analog scales were used to assess appetite sensations; furthermore, food and fluid intake of a test meal were recorded, and blood was sampled for analysis of plasma glucose and hormone levels. GLP-1 infusion enhanced satiety and fullness compared with placebo (P = 0.028 for fullness and P = 0.026 for hunger feelings). Energy intake was reduced by 27% by GLP-1 (P = 0.034) compared with saline. The results demonstrate a marked effect of GLP-1 on appetite by showing enhanced satiety and reduced energy intake in patients with diabetes type 2.  (+info)

(6/442) Central leptin modulates behavioral and neural responsivity to CCK.

The mechanisms through which leptin, the protein product of the ob gene, affects food intake remain to be determined. To assess whether the actions of leptin depend on modulation of within-meal satiety signals, we measured the effect of third ventricular leptin administration on the satiety actions of CCK. Leptin (10 micrograms) administered 1 h before 30-min access to a liquid diet had no effect on intake when administered alone, but doses of 3.5 or 10 micrograms dose dependently increased the suppression of intake produced by 1 nmol/kg CCK. Examination of patterns of c-Fos activation induced by 3.5 micrograms leptin and 1 nmol/kg CCK revealed that the combination produced significant c-Fos activation within the area postrema and the caudal and medial nucleus of the solitary tract (NST) compared with either leptin or CCK treatments alone. The leptin-CCK combination also resulted in increased c-Fos activation within the paraventricular nucleus of the hypothalamus above that produced by leptin alone. These data suggest that the actions of leptin in food intake are mediated through its ability to modulate responsivity to within-meal satiety signals.  (+info)

(7/442) Hyperglycemia attenuates the gastrokinetic effect of erythromycin and affects the perception of postprandial hunger in normal subjects.

OBJECTIVE: The major aims of this study were to determine in normal subjects whether the effects of erythromycin on gastric emptying, postprandial hunger, and fullness are modified by the blood glucose concentration. RESEARCH DESIGN AND METHODS: A total of 10 normal subjects (aged 20-39 years) underwent concurrent measurements of gastric emptying, blood glucose, hunger, and fullness on four separate occasions: twice during euglycemia (approximately 4 mmol/l) and twice during hyperglycemia (approximately 15 mmol/l). Either erythromycin (3 mg/kg) or saline (0.9%) was administered intravenously immediately before ingestion of a radioisotopically labeled solid meal. RESULTS: Gastric emptying was slower (P < 0.0001) during hyperglycemia when compared with euglycemia after both erythromycin and saline administration. During hyperglycemia, erythromycin reduced the lag phase (77.8 +/- 12.6 vs. 20.3 +/- 7.3 min; P < 0.05) but had no effect on the postlag emptying rate (0.32 +/- 0.077% per min vs. 0.24% per min). Hunger decreased (P < 0.001) and fullness increased (P < 0.001) after the meal. Postprandial hunger was less during hyperglycemia after saline infusion (P < 0.05) but not after erythromycin. Hunger was greater after erythromycin during both hyperglycemia and euglycemia (P < 0.05). CONCLUSIONS: At a blood glucose concentration of approximately 15 mmol/l, 1) gastric emptying of a solid meal is slower, when compared with euglycemia, even after administration of erythromycin; 2) the effect of erythromycin on gastric emptying of a solid meal is attenuated; and 3) the perception of postprandial hunger is reduced.  (+info)

(8/442) The role of apolipoprotein A-IV in food intake regulation.

Apolipoprotein (apo) A-IV is a glycoprotein synthesized by the human intestine. In rodents, both the small intestine and the liver secrete apo A-IV; the small intestine, however, is by far the major organ responsible for the circulating apo A-IV. Intestinal apo A-IV synthesis is markedly stimulated by fat absorption and appears not to be mediated by the uptake or reesterification of fatty acids to form triglycerides. Rather, it is the formation of chylomicrons that acts as a signal for the induction of intestinal apo A-IV synthesis. Intestinal apo A-IV synthesis is also enhanced by a factor from the ileum and that factor is probably peptide tyrosine-tyrosine (PYY). The inhibition of food intake by apo A-IV is probably mediated centrally. The stimulation of intestinal synthesis and secretion of apo A-IV by lipid absorption are rapid; thus, apo A-IV likely plays a role in the short-term regulation of food intake. Other evidence suggests that apo A-IV may also be involved in the long-term regulation of food intake and body weight. Chronic ingestion of a high fat diet blunts the intestinal apo A-IV response to lipid feeding and may explain why the chronic ingestion of a high fat diet predisposes both animals and humans to obesity.  (+info)

How can regain our natural reactions to hunger and satiation, and regain a healthy relationship with food?

Don't eat when you're distracted. Mindless munching while watching television or eating while you read a magazine/book will often cause you to overlook that you've had enough to eat. Eat thoughtfully, put your food/fork down between bites and listen to what your body is telling you. It may take some time, but you will start to eat differently.

Also, before you get something to eat, drink a glass of water. Oftentimes we're really thirsty instead of hungry.

My daughter has abdominal pain, fatigue, loss of appetite, early satiation when eating, and blood shot eyes.?

Any idea what this could be?

I really think that you should take her to a DOCTOR. Yahoo Answers is not a substitute for a doctor. Listing symptoms simply isn't gonna be enough for a diagnosis. There are LITERALLY a hundred thing these symptoms could be, but I'm sure that a doctor would be able to sort it out. One of the things about the medical field is that you really need to SEE and speak with a patient to sort them out. I'm giving you a link to a symptom checker at WebMD, but it really isn't that conducive. I still firmly suggest that you take her to a REAL doctor.

how much turkey should I put in my sandwich? How much is too much?

I've started counting calories and I can't figure out the amount of lean turkey breast to put in my sandwich. I am using low calorie (40 cals per slice) bread so I am trying to make the bulk of the sandwich turkey to maximize protein and satiation, but I am not using regular deli turkey, instead its sliced turkey breast that I have cooked. Is there any way to tell how much turkey is too much?


As turkey breast (cooked at home and not the deli processed stuff which is high in sodium) is very low in fat and calories so here is a guideline for  you!  Hope this helps you!  :)

Nutrition summary:
4 ounces ~ Calories 153 Fat 0.84g Carbs 0g Protein 34.09g 

There are 153 calories in 4 ounces of Turkey Breast Meat (Fryer-Roasters, Cooked, Roasted).

Calorie breakdown: 5% fat, 0% carbs, 95% protein.  (Protein is very good for you!)

Common serving sizes: Serving Size Calories 1 oz 38 
1 unit (yield from 1 lb ready-to-cook turkey) 117 100 g 135

1/2 breast, bone and skin removed 413

1 lb 612

How does the Atkins Diet work?

Does this diet essentially debunk the calories in / calories out heuristic? Or is it really just a satiation tool / calorie restriction diet in disguise? Or is the truth somewhere in the middle?

please help me with my spot satiation!:(?

I have my school prom in about 3 weeks,but ive just come out with loads of spots! does anyone recommend any treatment? but in the price range of about below £20? PLEASE HELP!!

sudocrem, vaseline ! drink lots of water and wash face 3 times a day.

how should i approach this satiation ( diling with STD'S)?

ok im 16 years old, and i had sex with this boy he was my frist we didnt us a condum twices. well i wasnt his frist. i ask hem how meany time have had unported sex. he said i was his frist, but i dont trust hem. i for got about it now where not to gether ,n im in a new relaship with dis boy.he is a vergin. n i made the choces to not have sex untile i get marid befor we got to gether. but laty been hereing about std . my shcool had donated blood. i didnt get the chans to but, it came back that they had to thowe out 73% of ower blood because of hiv, adis. im very woriyed n dont no wat to do.i want to get teted but dont wat tell my parnt until i kno 4 shore.w hat should i do?

Which macronutrient is most satiating?

Which macronutrient is most satiating? What two macronutrients are least satiating?  Comment on the good and bad of fat in terms of satiety vs satiation.

The three macronutrients are:

protein - most satiating
carbohydrates and fat are the least

For Anyone on Meridia for weightloss, HELP!!!?

I have recently been prescribed Meridia for weight loss, and today is my first day - so far no side effects, but also, no satiation. I don't think I have ever craved more, or been hungrier? Just curious, but anyone who has taken Meridia before, how long did it take for you to start noticing your appetite was controlled and cravings lessen? BTW I'm on the 10mg.

I used everything to lose weight, and nothing worked until I used acai berry.  I know they say that pills don't work, nevertheless they definitely worked for me, and they've been shown on CNN too.There is a free trial happening currently at , try it, how worse could it make things?