Meals: A portion of the food eaten for the day, usually at regular occasions during the day.Postprandial Period: The time frame after a meal or FOOD INTAKE.Eating: The consumption of edible substances.Food: Any substances taken in by the body that provide nourishment.Animal Feed: Foodstuff used especially for domestic and laboratory animals, or livestock.Feeding Behavior: Behavioral responses or sequences associated with eating including modes of feeding, rhythmic patterns of eating, and time intervals.Dietary Proteins: Proteins obtained from foods. They are the main source of the ESSENTIAL AMINO ACIDS.Soybeans: An annual legume. The SEEDS of this plant are edible and used to produce a variety of SOY FOODS.Satiation: Full gratification of a need or desire followed by a state of relative insensitivity to that particular need or desire.Digestion: The process of breakdown of food for metabolism and use by the body.Fish Products: Food products manufactured from fish (e.g., FISH FLOUR, fish meal).Dietary Carbohydrates: Carbohydrates present in food comprising digestible sugars and starches and indigestible cellulose and other dietary fibers. The former are the major source of energy. The sugars are in beet and cane sugar, fruits, honey, sweet corn, corn syrup, milk and milk products, etc.; the starches are in cereal grains, legumes (FABACEAE), tubers, etc. (From Claudio & Lagua, Nutrition and Diet Therapy Dictionary, 3d ed, p32, p277)Satiety Response: Behavioral response associated with the achieving of gratification.Diet: Regular course of eating and drinking adopted by a person or animal.Cross-Over Studies: Studies comparing two or more treatments or interventions in which the subjects or patients, upon completion of the course of one treatment, are switched to another. In the case of two treatments, A and B, half the subjects are randomly allocated to receive these in the order A, B and half to receive them in the order B, A. A criticism of this design is that effects of the first treatment may carry over into the period when the second is given. (Last, A Dictionary of Epidemiology, 2d ed)Nutritive Value: An indication of the contribution of a food to the nutrient content of the diet. This value depends on the quantity of a food which is digested and absorbed and the amounts of the essential nutrients (protein, fat, carbohydrate, minerals, vitamins) which it contains. This value can be affected by soil and growing conditions, handling and storage, and processing.Dietary Fats: Fats present in food, especially in animal products such as meat, meat products, butter, ghee. They are present in lower amounts in nuts, seeds, and avocados.Energy Intake: Total number of calories taken in daily whether ingested or by parenteral routes.Animal Nutritional Physiological Phenomena: Nutritional physiology of animals.Hunger: The desire for FOOD generated by a sensation arising from the lack of food in the STOMACH.Blood Glucose: Glucose in blood.Appetite: Natural recurring desire for food. Alterations may be induced by APPETITE DEPRESSANTS or APPETITE STIMULANTS.Random Allocation: A process involving chance used in therapeutic trials or other research endeavor for allocating experimental subjects, human or animal, between treatment and control groups, or among treatment groups. It may also apply to experiments on inanimate objects.Food Services: Functions, equipment, and facilities concerned with the preparation and distribution of ready-to-eat food.Fasting: Abstaining from all food.Intestinal Absorption: Uptake of substances through the lining of the INTESTINES.Zea mays: A plant species of the family POACEAE. It is a tall grass grown for its EDIBLE GRAIN, corn, used as food and animal FODDER.Insulin: A 51-amino acid pancreatic hormone that plays a major role in the regulation of glucose metabolism, directly by suppressing endogenous glucose production (GLYCOGENOLYSIS; GLUCONEOGENESIS) and indirectly by suppressing GLUCAGON secretion and LIPOLYSIS. Native insulin is a globular protein comprised of a zinc-coordinated hexamer. Each insulin monomer containing two chains, A (21 residues) and B (30 residues), linked by two disulfide bonds. Insulin is used as a drug to control insulin-dependent diabetes mellitus (DIABETES MELLITUS, TYPE 1).Food, Fortified: Any food that has been supplemented with essential nutrients either in quantities that are greater than those present normally, or which are not present in the food normally. Fortified food includes also food to which various nutrients have been added to compensate for those removed by refinement or processing. (From Segen, Dictionary of Modern Medicine, 1992)Dietary Fiber: The remnants of plant cell walls that are resistant to digestion by the alimentary enzymes of man. It comprises various polysaccharides and lignins.Swine: Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).Food Preferences: The selection of one food over another.Biological Availability: The extent to which the active ingredient of a drug dosage form becomes available at the site of drug action or in a biological medium believed to reflect accessibility to a site of action.Cottonseed Oil: Oil obtained from the seeds of Gossypium herbaceum L., the cotton plant. It is used in dietary products such as oleomargarine and many cooking oils. Cottonseed oil is commonly used in soaps and cosmetics.Stomach: An organ of digestion situated in the left upper quadrant of the abdomen between the termination of the ESOPHAGUS and the beginning of the DUODENUM.Menu PlanningFood Analysis: Measurement and evaluation of the components of substances to be taken as FOOD.Weight Gain: Increase in BODY WEIGHT over existing weight.Nitrogen: An element with the atomic symbol N, atomic number 7, and atomic weight [14.00643; 14.00728]. Nitrogen exists as a diatomic gas and makes up about 78% of the earth's atmosphere by volume. It is a constituent of proteins and nucleic acids and found in all living cells.Gastrointestinal Motility: The motor activity of the GASTROINTESTINAL TRACT.Lunch: The meal taken at midday.Cholecystokinin: A peptide, of about 33 amino acids, secreted by the upper INTESTINAL MUCOSA and also found in the central nervous system. It causes gallbladder contraction, release of pancreatic exocrine (or digestive) enzymes, and affects other gastrointestinal functions. Cholecystokinin may be the mediator of satiety.Amino Acids: Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.Phytic Acid: Complexing agent for removal of traces of heavy metal ions. It acts also as a hypocalcemic agent.Gastrointestinal Transit: Passage of food (sometimes in the form of a test meal) through the gastrointestinal tract as measured in minutes or hours. The rate of passage through the intestine is an indicator of small bowel function.Rumen: The first stomach of ruminants. It lies on the left side of the body, occupying the whole of the left side of the abdomen and even stretching across the median plane of the body to the right side. It is capacious, divided into an upper and a lower sac, each of which has a blind sac at its posterior extremity. The rumen is lined by mucous membrane containing no digestive glands, but mucus-secreting glands are present in large numbers. Coarse, partially chewed food is stored and churned in the rumen until the animal finds circumstances convenient for rumination. When this occurs, little balls of food are regurgitated through the esophagus into the mouth, and are subjected to a second more thorough mastication, swallowed, and passed on into other parts of the compound stomach. (From Black's Veterinary Dictionary, 17th ed)Bread: Baked food product made of flour or meal that is moistened, kneaded, and sometimes fermented. A major food since prehistoric times, it has been made in various forms using a variety of ingredients and methods.Glycemic Index: A numerical system of measuring the rate of BLOOD GLUCOSE generation from a particular food item as compared to a reference item, such as glucose = 100. Foods with higher glycemic index numbers create greater blood sugar swings.Food, Formulated: Food and dietary formulations including elemental (chemically defined formula) diets, synthetic and semisynthetic diets, space diets, weight-reduction formulas, tube-feeding diets, complete liquid diets, and supplemental liquid and solid diets.Body Weight: The mass or quantity of heaviness of an individual. It is expressed by units of pounds or kilograms.Energy Metabolism: The chemical reactions involved in the production and utilization of various forms of energy in cells.Meat: The edible portions of any animal used for food including domestic mammals (the major ones being cattle, swine, and sheep) along with poultry, fish, shellfish, and game.TriglyceridesFood Handling: Any aspect of the operations in the preparation, processing, transport, storage, packaging, wrapping, exposure for sale, service, or delivery of food.Time Factors: Elements of limited time intervals, contributing to particular results or situations.6-Phytase: An enzyme that catalyzes the conversion of myo-inositol hexakisphosphate and water to 1L-myo-inositol 1,2,3,4,5-pentakisphosphate and orthophosphate. EC 3.1.3.26.Area Under Curve: A statistical means of summarizing information from a series of measurements on one individual. It is frequently used in clinical pharmacology where the AUC from serum levels can be interpreted as the total uptake of whatever has been administered. As a plot of the concentration of a drug against time, after a single dose of medicine, producing a standard shape curve, it is a means of comparing the bioavailability of the same drug made by different companies. (From Winslade, Dictionary of Clinical Research, 1992)Gastrointestinal Contents: The contents included in all or any segment of the GASTROINTESTINAL TRACT.Duodenum: The shortest and widest portion of the SMALL INTESTINE adjacent to the PYLORUS of the STOMACH. It is named for having the length equal to about the width of 12 fingers.Gastric Inhibitory Polypeptide: A gastrointestinal peptide hormone of about 43-amino acids. It is found to be a potent stimulator of INSULIN secretion and a relatively poor inhibitor of GASTRIC ACID secretion.Vegetable Proteins: Proteins which are present in or isolated from vegetables or vegetable products used as food. The concept is distinguished from PLANT PROTEINS which refers to non-dietary proteins from plants.Feathers: Flat keratinous structures found on the skin surface of birds. Feathers are made partly of a hollow shaft fringed with barbs. They constitute the plumage.Absorption: The physical or physiological processes by which substances, tissue, cells, etc. take up or take in other substances or energy.Appetite Regulation: Physiologic mechanisms which regulate or control the appetite and food intake.Cereals: Seeds from grasses (POACEAE) which are important in the diet.Glucagon-Like Peptide 1: A peptide of 36 or 37 amino acids that is derived from PROGLUCAGON and mainly produced by the INTESTINAL L CELLS. GLP-1(1-37 or 1-36) is further N-terminally truncated resulting in GLP-1(7-37) or GLP-1-(7-36) which can be amidated. These GLP-1 peptides are known to enhance glucose-dependent INSULIN release, suppress GLUCAGON release and gastric emptying, lower BLOOD GLUCOSE, and reduce food intake.Breakfast: The first meal of the day.Soybean Proteins: Proteins which are present in or isolated from SOYBEANS.Gastric Juice: The liquid secretion of the stomach mucosa consisting of hydrochloric acid (GASTRIC ACID); PEPSINOGENS; INTRINSIC FACTOR; GASTRIN; MUCUS; and the bicarbonate ion (BICARBONATES). (From Best & Taylor's Physiological Basis of Medical Practice, 12th ed, p651)Ghrelin: A 28-amino acid, acylated, orexigenic peptide that is a ligand for GROWTH HORMONE SECRETAGOGUE RECEPTORS. Ghrelin is widely expressed but primarily in the stomach in the adults. Ghrelin acts centrally to stimulate growth hormone secretion and food intake, and peripherally to regulate energy homeostasis. Its large precursor protein, known as appetite-regulating hormone or motilin-related peptide, contains ghrelin and obestatin.Ileum: The distal and narrowest portion of the SMALL INTESTINE, between the JEJUNUM and the ILEOCECAL VALVE of the LARGE INTESTINE.Peptide YY: A 36-amino acid peptide produced by the L cells of the distal small intestine and colon. Peptide YY inhibits gastric and pancreatic secretion.Vegetables: A food group comprised of EDIBLE PLANTS or their parts.Food Habits: Acquired or learned food preferences.Cattle: Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor.Weaning: Permanent deprivation of breast milk and commencement of nourishment with other food. (From Stedman, 25th ed)Fermentation: Anaerobic degradation of GLUCOSE or other organic nutrients to gain energy in the form of ATP. End products vary depending on organisms, substrates, and enzymatic pathways. Common fermentation products include ETHANOL and LACTIC ACID.Dietary Supplements: Products in capsule, tablet or liquid form that provide dietary ingredients, and that are intended to be taken by mouth to increase the intake of nutrients. Dietary supplements can include macronutrients, such as proteins, carbohydrates, and fats; and/or MICRONUTRIENTS, such as VITAMINS; MINERALS; and PHYTOCHEMICALS.Iron Isotopes: Stable iron atoms that have the same atomic number as the element iron, but differ in atomic weight. Fe-54, 57, and 58 are stable iron isotopes.Starch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Molasses: The syrup remaining after sugar is crystallized out of SUGARCANE or sugar beet juice. It is also used in ANIMAL FEED, and in a fermented form, is used to make industrial ETHYL ALCOHOL and ALCOHOLIC BEVERAGES.Caseins: A mixture of related phosphoproteins occurring in milk and cheese. The group is characterized as one of the most nutritive milk proteins, containing all of the common amino acids and rich in the essential ones.Phosphorus, Dietary: Phosphorus used in foods or obtained from food. This element is a major intracellular component which plays an important role in many biochemical pathways relating to normal physiological functions. High concentrations of dietary phosphorus can cause nephrocalcinosis which is associated with impaired kidney function. Low concentrations of dietary phosphorus cause an increase in calcitriol in the blood and osteoporosis.Beverages: Liquids that are suitable for drinking. (From Merriam Webster Collegiate Dictionary, 10th ed)Fatty Acids, Nonesterified: FATTY ACIDS found in the plasma that are complexed with SERUM ALBUMIN for transport. These fatty acids are not in glycerol ester form.Obesity: A status with BODY WEIGHT that is grossly above the acceptable or desirable weight, usually due to accumulation of excess FATS in the body. The standards may vary with age, sex, genetic or cultural background. In the BODY MASS INDEX, a BMI greater than 30.0 kg/m2 is considered obese, and a BMI greater than 40.0 kg/m2 is considered morbidly obese (MORBID OBESITY).Diabetic Diet: A diet prescribed in the treatment of diabetes mellitus, usually limited in the amount of sugar or readily available carbohydrate. (Dorland, 27th ed)Breath Tests: Any tests done on exhaled air.Gastrins: A family of gastrointestinal peptide hormones that excite the secretion of GASTRIC JUICE. They may also occur in the central nervous system where they are presumed to be neurotransmitters.Peptones: Derived proteins or mixtures of cleavage products produced by the partial hydrolysis of a native protein either by an acid or by an enzyme. Peptones are readily soluble in water, and are not precipitable by heat, by alkalis, or by saturation with ammonium sulfate. (Dorland, 28th ed)Blood Urea Nitrogen: The urea concentration of the blood stated in terms of nitrogen content. Serum (plasma) urea nitrogen is approximately 12% higher than blood urea nitrogen concentration because of the greater protein content of red blood cells. Increases in blood or serum urea nitrogen are referred to as azotemia and may have prerenal, renal, or postrenal causes. (From Saunders Dictionary & Encyclopedia of Laboratory Medicine and Technology, 1984)Cooking: The art or practice of preparing food. It includes the preparation of special foods for diets in various diseases.Dietary Sucrose: Sucrose present in the diet. It is added to food and drinks as a sweetener.Body Composition: The relative amounts of various components in the body, such as percentage of body fat.Technetium Tc 99m Sulfur Colloid: A gamma-emitting radionuclide imaging agent used for the diagnosis of diseases in many tissues, particularly in the gastrointestinal system, liver, and spleen.Iron Radioisotopes: Unstable isotopes of iron that decay or disintegrate emitting radiation. Fe atoms with atomic weights 52, 53, 55, and 59-61 are radioactive iron isotopes.Flour: Ground up seed of WHEAT.Triticum: A plant genus of the family POACEAE that is the source of EDIBLE GRAIN. A hybrid with rye (SECALE CEREALE) is called TRITICALE. The seed is ground into FLOUR and used to make BREAD, and is the source of WHEAT GERM AGGLUTININS.Digestive System Physiological Phenomena: Properties and processes of the DIGESTIVE SYSTEM as a whole or of any of its parts.C-Peptide: The middle segment of proinsulin that is between the N-terminal B-chain and the C-terminal A-chain. It is a pancreatic peptide of about 31 residues, depending on the species. Upon proteolytic cleavage of proinsulin, equimolar INSULIN and C-peptide are released. C-peptide immunoassay has been used to assess pancreatic beta cell function in diabetic patients with circulating insulin antibodies or exogenous insulin. Half-life of C-peptide is 30 min, almost 8 times that of insulin.Pancreatic Polypeptide: A 36-amino acid pancreatic hormone that is secreted mainly by endocrine cells found at the periphery of the ISLETS OF LANGERHANS and adjacent to cells containing SOMATOSTATIN and GLUCAGON. Pancreatic polypeptide (PP), when administered peripherally, can suppress gastric secretion, gastric emptying, pancreatic enzyme secretion, and appetite. A lack of pancreatic polypeptide (PP) has been associated with OBESITY in rats and mice.Chromium Compounds: Inorganic compounds that contain chromium as an integral part of the molecule.Brassica: A plant genus of the family Cruciferae. It contains many species and cultivars used as food including cabbage, cauliflower, broccoli, Brussel sprouts, kale, collard greens, MUSTARD PLANT; (B. alba, B. junica, and B. nigra), turnips (BRASSICA NAPUS) and rapeseed (BRASSICA RAPA).Glucagon: A 29-amino acid pancreatic peptide derived from proglucagon which is also the precursor of intestinal GLUCAGON-LIKE PEPTIDES. Glucagon is secreted by PANCREATIC ALPHA CELLS and plays an important role in regulation of BLOOD GLUCOSE concentration, ketone metabolism, and several other biochemical and physiological processes. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1511)Milk: The white liquid secreted by the mammary glands. It contains proteins, sugar, lipids, vitamins, and minerals.Circadian Rhythm: The regular recurrence, in cycles of about 24 hours, of biological processes or activities, such as sensitivity to drugs and stimuli, hormone secretion, sleeping, and feeding.Fatty Acids, Volatile: Short-chain fatty acids of up to six carbon atoms in length. They are the major end products of microbial fermentation in the ruminant digestive tract and have also been implicated in the causation of neurological diseases in humans.Plant Gums: Polysaccharide gums from PLANTS.Poaceae: A large family of narrow-leaved herbaceous grasses of the order Cyperales, subclass Commelinidae, class Liliopsida (monocotyledons). Food grains (EDIBLE GRAIN) come from members of this family. RHINITIS, ALLERGIC, SEASONAL can be induced by POLLEN of many of the grasses.Plant Oils: Oils derived from plants or plant products.Gastrointestinal Hormones: HORMONES secreted by the gastrointestinal mucosa that affect the timing or the quality of secretion of digestive enzymes, and regulate the motor activity of the digestive system organs.Zinc Radioisotopes: Unstable isotopes of zinc that decay or disintegrate emitting radiation. Zn atoms with atomic weights 60-63, 65, 69, 71, and 72 are radioactive zinc isotopes.Intubation, Gastrointestinal: The insertion of a tube into the stomach, intestines, or other portion of the gastrointestinal tract to allow for the passage of food products, etc.RestaurantsFast Foods: Prepared food that is ready to eat or partially prepared food that has a final preparation time of a few minutes or less.Silage: Fodder converted into succulent feed for livestock through processes of anaerobic fermentation (as in a silo).Minerals: Native, inorganic or fossilized organic substances having a definite chemical composition and formed by inorganic reactions. They may occur as individual crystals or may be disseminated in some other mineral or rock. (Grant & Hackh's Chemical Dictionary, 5th ed; McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Gallbladder Emptying: A process whereby bile is delivered from the gallbladder into the duodenum. The emptying is caused by both contraction of the gallbladder and relaxation of the sphincter mechanism at the choledochal terminus.Feeding Methods: Methods of giving food to humans or animals.Urea: A compound formed in the liver from ammonia produced by the deamination of amino acids. It is the principal end product of protein catabolism and constitutes about one half of the total urinary solids.Blood: The body fluid that circulates in the vascular system (BLOOD VESSELS). Whole blood includes PLASMA and BLOOD CELLS.Phosphorus: A non-metal element that has the atomic symbol P, atomic number 15, and atomic weight 31. It is an essential element that takes part in a broad variety of biochemical reactions.Feces: Excrement from the INTESTINES, containing unabsorbed solids, waste products, secretions, and BACTERIA of the DIGESTIVE SYSTEM.Drinking: The consumption of liquids.Nutritional Requirements: The amounts of various substances in food needed by an organism to sustain healthy life.Glucose: A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.Poultry Products: Food products manufactured from poultry.Fruit: The fleshy or dry ripened ovary of a plant, enclosing the seed or seeds.Gastric Acid: Hydrochloric acid present in GASTRIC JUICE.Calorimetry, Indirect: Calculation of the energy expenditure in the form of heat production of the whole body or individual organs based on respiratory gas exchange.Chylomicrons: A class of lipoproteins that carry dietary CHOLESTEROL and TRIGLYCERIDES from the SMALL INTESTINE to the tissues. Their density (0.93-1.006 g/ml) is the same as that of VERY-LOW-DENSITY LIPOPROTEINS.Snacks: Foods eaten between MEALTIMES.Fabaceae: The large family of plants characterized by pods. Some are edible and some cause LATHYRISM or FAVISM and other forms of poisoning. Other species yield useful materials like gums from ACACIA and various LECTINS like PHYTOHEMAGGLUTININS from PHASEOLUS. Many of them harbor NITROGEN FIXATION bacteria on their roots. Many but not all species of "beans" belong to this family.Analysis of Variance: A statistical technique that isolates and assesses the contributions of categorical independent variables to variation in the mean of a continuous dependent variable.Galactans: Polysaccharides composed of repeating galactose units. They can consist of branched or unbranched chains in any linkages.Fatty Acids: Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)Glutens: Prolamins in the endosperm of SEEDS from the Triticeae tribe which includes species of WHEAT; BARLEY; and RYE.Hypoglycemic Agents: Substances which lower blood glucose levels.Iron: A metallic element with atomic symbol Fe, atomic number 26, and atomic weight 55.85. It is an essential constituent of HEMOGLOBINS; CYTOCHROMES; and IRON-BINDING PROTEINS. It plays a role in cellular redox reactions and in the transport of OXYGEN.Lipids: A generic term for fats and lipoids, the alcohol-ether-soluble constituents of protoplasm, which are insoluble in water. They comprise the fats, fatty oils, essential oils, waxes, phospholipids, glycolipids, sulfolipids, aminolipids, chromolipids (lipochromes), and fatty acids. (Grant & Hackh's Chemical Dictionary, 5th ed)Secretin: A peptide hormone of about 27 amino acids from the duodenal mucosa that activates pancreatic secretion and lowers the blood sugar level. (USAN and the USP Dictionary of Drug Names, 1994, p597)Gastrointestinal Tract: Generally refers to the digestive structures stretching from the MOUTH to ANUS, but does not include the accessory glandular organs (LIVER; BILIARY TRACT; PANCREAS).Ammonia: A colorless alkaline gas. It is formed in the body during decomposition of organic materials during a large number of metabolically important reactions. Note that the aqueous form of ammonia is referred to as AMMONIUM HYDROXIDE.Food Deprivation: The withholding of food in a structured experimental situation.Insect Vectors: Insects that transmit infective organisms from one host to another or from an inanimate reservoir to an animate host.Food Additives: Substances which are of little or no nutritive value, but are used in the processing or storage of foods or animal feed, especially in the developed countries; includes ANTIOXIDANTS; FOOD PRESERVATIVES; FOOD COLORING AGENTS; FLAVORING AGENTS; ANTI-INFECTIVE AGENTS (both plain and LOCAL); VEHICLES; EXCIPIENTS and other similarly used substances. Many of the same substances are PHARMACEUTIC AIDS when added to pharmaceuticals rather than to foods.Food-Drug Interactions: The pharmacological result, either desirable or undesirable, of drugs interacting with components of the diet. (From Stedman, 25th ed)Diabetes Mellitus, Type 2: A subclass of DIABETES MELLITUS that is not INSULIN-responsive or dependent (NIDDM). It is characterized initially by INSULIN RESISTANCE and HYPERINSULINEMIA; and eventually by GLUCOSE INTOLERANCE; HYPERGLYCEMIA; and overt diabetes. Type II diabetes mellitus is no longer considered a disease exclusively found in adults. Patients seldom develop KETOSIS but often exhibit OBESITY.Eggs: Animal reproductive bodies, or the contents thereof, used as food. The concept is differentiated from OVUM, the anatomic or physiologic entity.Gastroparesis: Chronic delayed gastric emptying. Gastroparesis may be caused by motor dysfunction or paralysis of STOMACH muscles or may be associated with other systemic diseases such as DIABETES MELLITUS.Aedes: A genus of mosquitoes (CULICIDAE) frequently found in tropical and subtropical regions. YELLOW FEVER and DENGUE are two of the diseases that can be transmitted by species of this genus.Vagotomy: The interruption or removal of any part of the vagus (10th cranial) nerve. Vagotomy may be performed for research or for therapeutic purposes.Fish Flour: A flour made of pulverized, dried fish or fish parts.Apolipoprotein B-48: A 241-kDa protein synthesized only in the INTESTINES. It serves as a structural protein of CHYLOMICRONS. Its exclusive association with chylomicron particles provides an indicator of intestinally derived lipoproteins in circulation. Apo B-48 is a shortened form of apo B-100 and lacks the LDL-receptor region.Medicago sativa: A plant species of the family FABACEAE widely cultivated for ANIMAL FEED.Nutritional Physiological Phenomena: The processes and properties of living organisms by which they take in and balance the use of nutritive materials for energy, heat production, or building material for the growth, maintenance, or repair of tissues and the nutritive properties of FOOD.Intestine, Small: The portion of the GASTROINTESTINAL TRACT between the PYLORUS of the STOMACH and the ILEOCECAL VALVE of the LARGE INTESTINE. It is divisible into three portions: the DUODENUM, the JEJUNUM, and the ILEUM.Fats: The glyceryl esters of a fatty acid, or of a mixture of fatty acids. They are generally odorless, colorless, and tasteless if pure, but they may be flavored according to origin. Fats are insoluble in water, soluble in most organic solvents. They occur in animal and vegetable tissue and are generally obtained by boiling or by extraction under pressure. They are important in the diet (DIETARY FATS) as a source of energy. (Grant & Hackh's Chemical Dictionary, 5th ed)Reference Values: The range or frequency distribution of a measurement in a population (of organisms, organs or things) that has not been selected for the presence of disease or abnormality.Schools: Educational institutions.Adolescent Nutritional Physiological Phenomena: Nutritional physiology of children aged 13-18 years.Pyloric Antrum: The region between the sharp indentation at the lower third of the STOMACH (incisura angularis) and the junction of the PYLORUS with the DUODENUM. Pyloric antral glands contain mucus-secreting cells and gastrin-secreting endocrine cells (G CELLS).Digestive System: A group of organs stretching from the MOUTH to the ANUS, serving to breakdown foods, assimilate nutrients, and eliminate waste. In humans, the digestive system includes the GASTROINTESTINAL TRACT and the accessory glands (LIVER; BILIARY TRACT; PANCREAS).Soybean Oil: Oil from soybean or soybean plant.Cocos: A plant genus of the family ARECACEAE. It is a tropical palm tree that yields a large, edible hard-shelled fruit from which oil and fiber are also obtained.Carbon Isotopes: Stable carbon atoms that have the same atomic number as the element carbon, but differ in atomic weight. C-13 is a stable carbon isotope.Panicum: A plant genus of the family POACEAE. The seed is one of the EDIBLE GRAINS used in millet cereals and in feed for birds and livestock (ANIMAL FEED). It contains diosgenin (SAPONINS).Triolein: (Z)-9-Octadecenoic acid 1,2,3-propanetriyl ester.Gastric Acidity Determination: Gastric analysis for determination of free acid or total acid.Barium Sulfate: A compound used as an x-ray contrast medium that occurs in nature as the mineral barite. It is also used in various manufacturing applications and mixed into heavy concrete to serve as a radiation shield.Hordeum: A plant genus of the family POACEAE. The EDIBLE GRAIN, barley, is widely used as food.Hydrogen-Ion Concentration: The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Weight Loss: Decrease in existing BODY WEIGHT.Hyperphagia: Ingestion of a greater than optimal quantity of food.Arachis hypogaea: A plant species of the family FABACEAE that yields edible seeds, the familiar peanuts, which contain protein, oil and lectins.Body Mass Index: An indicator of body density as determined by the relationship of BODY WEIGHT to BODY HEIGHT. BMI=weight (kg)/height squared (m2). BMI correlates with body fat (ADIPOSE TISSUE). Their relationship varies with age and gender. For adults, BMI falls into these categories: below 18.5 (underweight); 18.5-24.9 (normal); 25.0-29.9 (overweight); 30.0 and above (obese). (National Center for Health Statistics, Centers for Disease Control and Prevention)Insulin Infusion Systems: Portable or implantable devices for infusion of insulin. Includes open-loop systems which may be patient-operated or controlled by a pre-set program and are designed for constant delivery of small quantities of insulin, increased during food ingestion, and closed-loop systems which deliver quantities of insulin automatically based on an electronic glucose sensor.Amino Acids, Essential: Amino acids that are not synthesized by the human body in amounts sufficient to carry out physiological functions. They are obtained from dietary foodstuffs.Avena sativa: A plant species of the family POACEAE that is widely cultivated for its edible seeds.Nutritional Status: State of the body in relation to the consumption and utilization of nutrients.Administration, Oral: The giving of drugs, chemicals, or other substances by mouth.Food Irradiation: Treatment of food with RADIATION.Zinc Isotopes: Stable zinc atoms that have the same atomic number as the element zinc, but differ in atomic weight. Zn-66-68, and 70 are stable zinc isotopes.Calcium, Dietary: Calcium compounds used as food supplements or in food to supply the body with calcium. Dietary calcium is needed during growth for bone development and for maintenance of skeletal integrity later in life to prevent osteoporosis.Bulimia: Eating an excess amount of food in a short period of time, as seen in the disorder of BULIMIA NERVOSA. It is caused by an abnormal craving for food, or insatiable hunger also known as "ox hunger".Lysine: An essential amino acid. It is often added to animal feed.Taste: The ability to detect chemicals through gustatory receptors in the mouth, including those on the TONGUE; the PALATE; the PHARYNX; and the EPIGLOTTIS.Iron, Dietary: Iron or iron compounds used in foods or as food. Dietary iron is important in oxygen transport and the synthesis of the iron-porphyrin proteins hemoglobin, myoglobin, cytochromes, and cytochrome oxidase. Insufficient amounts of dietary iron can lead to iron-deficiency anemia.Ileostomy: Surgical creation of an external opening into the ILEUM for fecal diversion or drainage. This replacement for the RECTUM is usually created in patients with severe INFLAMMATORY BOWEL DISEASES. Loop (continent) or tube (incontinent) procedures are most often employed.Manometry: Measurement of the pressure or tension of liquids or gases with a manometer.Technetium Tc 99m Lidofenin: A nontoxic radiopharmaceutical that is used in RADIONUCLIDE IMAGING for the clinical evaluation of hepatobiliary disorders in humans.Adipose Tissue: Specialized connective tissue composed of fat cells (ADIPOCYTES). It is the site of stored FATS, usually in the form of TRIGLYCERIDES. In mammals, there are two types of adipose tissue, the WHITE FAT and the BROWN FAT. Their relative distributions vary in different species with most adipose tissue being white.Overweight: A status with BODY WEIGHT that is above certain standard of acceptable or desirable weight. In the scale of BODY MASS INDEX, overweight is defined as having a BMI of 25.0-29.9 kg/m2. Overweight may or may not be due to increases in body fat (ADIPOSE TISSUE), hence overweight does not equal "over fat".Diet Records: Records of nutrient intake over a specific period of time, usually kept by the patient.Nutrition Policy: Guidelines and objectives pertaining to food supply and nutrition including recommendations for healthy diet.Duodenal Ulcer: A PEPTIC ULCER located in the DUODENUM.Double-Blind Method: A method of studying a drug or procedure in which both the subjects and investigators are kept unaware of who is actually getting which specific treatment.Lactation: The processes of milk secretion by the maternal MAMMARY GLANDS after PARTURITION. The proliferation of the mammary glandular tissue, milk synthesis, and milk expulsion or let down are regulated by the interactions of several hormones including ESTRADIOL; PROGESTERONE; PROLACTIN; and OXYTOCIN.Sheep: Any of the ruminant mammals with curved horns in the genus Ovis, family Bovidae. They possess lachrymal grooves and interdigital glands, which are absent in GOATS.Sodium Glutamate: One of the FLAVORING AGENTS used to impart a meat-like flavor.Basal Metabolism: Heat production, or its measurement, of an organism at the lowest level of cell chemistry in an inactive, awake, fasting state. It may be determined directly by means of a calorimeter or indirectly by calculating the heat production from an analysis of the end products of oxidation within the organism or from the amount of oxygen utilized.

*  Bean Recipes & Meal Ideas: Beans Make the Meal | Bush’s Beans
... Bean Recipes & Meal Ideas: Beans Make the Meal. Bush’s Beans. Recipes & Inspiration All Recipes. Home Recipes Inspiration Products The Bean Life About Us. Subnav Recipes Browse All Recipes Black Bean Recipes Chili Recipes Vegetarian Recipes Quick Easy Recipes Kid Friendly Recipes Latin-Inspired Recipes Recipe Math View Recipes Inspiration. BUSH'S® Easy White Chicken Chili. BUSH S® Easy White Chicken Chili BUSH S® White Chili Beans make this easy recipe a family favorite. BUSH'S® MEATLESS BLACK BEAN CHILI. BUSH S® MEATLESS BLACK BEAN CHILI With BUSH S® Chili Beans, it s easy to cook up a perfect pot of chili every time. Subnav Products Baked Beans Grillin Beans® Variety Beans Reduced Sodium Beans Chili Beans and Starters Limited Edition Latin-Inspired Flavors View All Products. BUSH'S® ASIAN BBQ. BUSH S® ASIAN BBQ Delicious red beans are simmered in an Asian-inspired barbecue sauce with a hint of ginger. BUSH'S® WHITE CHILI BEANS. BUSH S® WHITE CHILI BEANS Tender great northern beans simmered in a white ch...
http://bushbeans.com/en_US/recipes/
*  Ready Meals | Frozen | Iceland
Ready Meals. Frozen. Iceland. FREE DELIVERY. ... 14. Fish Pies & Meals 6. Meat 159. Breaded & Battered ... Pizzas 23. Ready Meals 108. American 11. Chinese & Oriental ... Ready Meals. Frozen. Iceland. FREE DELIVERY. Register or Sign In. . Accept Close. My Favourites. Offers. Frozen 134. Chilled 173. Food Cupboard 240. Fresh 53. Non-Food 46. Drinks 152. Frozen. Chips & Potato Products 52. Chips 22. Potato Products 30. Desserts & Ice Cream 86. Desserts 27. Frozen Fruit 4. Ice Cream Tubs & Desserts 15. Hot Puddings 12. Lollies, Cones & Choc Ices 29. Fish & Seafood 74. Battered & Breaded Fish 17. Fish Fillets & Steaks 23. Fish Fingers, Fish Cakes & Scampi 11. Prawns & Seafood 6. Speciality Fish 14. Fish Pies & Meals 6. Meat 159. Breaded & Battered Chicken 47. Beef 11. Burgers 19. Lamb 17. Pork 22. Chicken & Turkey 30. Sausages 18. Speciality Meat 11. Frozen Bread & Pastries 13. Party Food & Desserts 18. Pies & Pastry 35. Pasties, Quiche & Sausage Rolls 14. Pies & Puddings 20. Greggs 9. Pizza & Garl...
http://groceries.iceland.co.uk/frozen-ready-meals
*  Calories in Dunkin' Donuts - White Hot Chocolate Medium | Nutrition and Health Facts
Weight Log Analysis Meals Favorites Recipes Custom Foods. ... Calories in Dunkin' Donuts - White Hot Chocolate Medium. Food Log Activity Log Weight Log Analysis Meals Favorites Recipes Custom Foods. Overview Food Browser Recipe Browser New Recipe. Overview Activity Browser Exercise Plan Workout Center Beginner's Corner. Foods Activities Recipes Forums Groups. Overview. Food Browser. Recipe Browser. Calories in White Hot Chocolate Medium. Hot Chocolate. Wondering how many calories are in White Hot Chocolate Medium. Manufactured by Dunkin' Donuts. fl.oz 14 fl.oz grams oz cal. Add to Log White Hot Chocolate Medium. White Hot Chocolate Medium D+ Grade 340 Calories. Nutrition Facts Serving Size 14 fl.oz 392 g Per Serving % Daily Value* Calories 340 Calories from Fat 117 Total Fat 13 g 20 % Saturated Fat 11 g 55 % Sodium 460 mg 19 % Carbohydrates 56 g 19 % Sugars 45 g Protein 3 g. White Hot Chocolate Medium Calories and Health Benefits. Fat. BAD POINTS High in saturated fat Very high in sugar. Get Nutritional Fac...
http://caloriecount.com/calories-dunkin-donuts-white-hot-chocolate-i140894
*  How to Curb Sugar Cravings and Conquer a Sweet Tooth | Blog
... How to Curb Sugar Cravings and Conquer a Sweet Tooth. Weight Loss Percentage Calculator. Lose Weight. Weight Loss. How to Curb Sugar Cravings and Conquer a Sweet Tooth Published by FitWatch. Reducing sugar intake is an important step in any weight loss or health program, simply because it helps you consume fewer calories and maintain better health. Below are a few tips to curb sugar cravings and loosen the grip that sugar has on you: #1 - Plenty of water Before you even start cutting down your sugar consumption, you may want to focus on boosting your daily water intake. SEE ALSO: How To Keep Your Body Hydrated #2 - More protein Cravings for sugar are often caused by dipping blood glucose levels, and eating protein regularly helps to stabilize your blood sugar. Including a serving or two of protein in each meal will help your stomach empty more slowly, which helps you avoid large spikes in blood sugar - which means you are less likely to experience low blood sugar and the intense sugar cravings that come a...
https://fitwatch.com/blog/how-to-curb-sugar-cravings-and-conquer-a-sweet-tooth
*  Grilled Pesto Chicken Packs
Recipes. Everyday Meals. Desserts. Snacks. Holidays & ... Grilled Pesto Chicken Packs. Recipes. Everyday Meals. Snacks. Holidays & Entertaining. How-To. Products. Coupons & Sales. Back to Recipe Page. Grilled Pesto Chicken Packs. Prep Time 15 min. Total Time 40 min. Servings 4. Ingredients Ingredients. 4 boneless skinless chicken breast halves 1 1/4 pounds. 8. roma plum tomatoes, cut into 1/2 inch slices. 4. small zucchini, cut into 1/2-inch slices. 1/2. cup basil pesto. Directions Directions 1 Heat coals or gas grill for direct heat. Place 1 chicken breast half, 2 sliced tomatoes and 1 sliced zucchini on one side of four 18x12-inch sheets of heavy-duty aluminum foil. Spoon 2 tablespoons pesto over chicken mixture on each sheet. 2 Fold foil over chicken and vegetables so edges meet. Seal edges, making tight 1/2-inch fold; fold again. Allow space on sides for circulation and expansion. 3 Cover and grill packets 4 to 5 inches from medium heat 20 to 25 minutes or until juice of chicken is no longer pink whe...
http://bettycrocker.com/recipes/grilled-pesto-chicken-packs/93ef5089-819d-4432-9265-0ff0aa58ac0e?sc=Grilled Main Dish Recipes&term=Grill Main Dish&itemId=95ab9623-9b60-421d-b06f-1e9703847148&p=1
*  These highlights do not include all the information needed to use rabeprazole sodium delayed-release
... 1.1 Healing of Erosive or Ulcerative GERD in Adults Rabeprazole Sodium Delayed-Release Tablets is indicated for short-term 4 to 8 weeks treatment in the healing and symptomatic relief of erosive or ulcerative gastroesophageal reflux disease GERD. 1.4 Healing of Duodenal Ulcers in Adults Rabeprazole Sodium Delayed-Release Tablets is indicated for short-term up to four weeks treatment in the healing and symptomatic relief of duodenal ulcers. 2.1 Healing of Erosive or Ulcerative GERD in Adults The recommended adult oral dose is one Rabeprazole Sodium 20 mg Delayed-Release Tablet to be taken once daily for four to eight weeks. 2.2 Maintenance of Healing of Erosive or Ulcerative GERD in Adults The recommended adult oral dose is one Rabeprazole Sodium 20 mg Delayed-Release Tablet to be taken once daily. 2.3 Treatment of Symptomatic GERD in Adults The recommended adult oral dose is one Rabeprazole Sodium 20 mg Delayed-Release Tablet to be taken once daily for 4 weeks. + + TABLE 3 GASTRIC ACID PARAMETERS RABEPRAZ...
http://dailymed.nlm.nih.gov/dailymed/fda/fdaDrugXsl.cfm?setid=8699d125-0928-458f-a232-9864497c73cb&type=display
*  Send page by e-mail | Crystal Creek Meadows Luxury Spa Accommodation NSW Australia
Services B B Meals and Food Romantic Country Weddings ... Crystal Creek Meadows Luxury Spa Accommodation NSW Australia. Crystal Creek Meadows Luxury Cottages Day Spa Retreat - Kangaroo Valley NSW Phone: +61 0 2 4465 1406 AAA Tourism 4 Star Self Contained B B Accommodation. Packages Specials. Aromatherapy Gift Shop. Accommodation Overview Luxury Cottages - Details. Rose Garden Cottage Fleur Farm Cottage Jolly Jumbuck Cottage Billabong Spa Cottage Luxury At A Glance Property Gardens Accessible Holidays Reservations Information. Luxury Day Spa Overview A La Carte Spa Menu Spa Retreat Packages Activities On Property Luxury Accommodation Services B B Meals and Food Romantic Country Weddings Specials. Last Minute Specials Romantic Couples Packages Family Holiday Packages Group Accommodation Packages Packages Comparison Chart View All Packages Photos. Rose Garden Photos Fluer Farm Cottage Photos Jolly Jumbuck Cottage Photos Billabong Spa Cottage Photos Day Spa Retreat Photos Gardens Property Photos Services Facilit...
http://crystalcreekmeadows.com.au/printmail/421
*  Household Products Database - Health and Safety Information on Household Products
... Bonide DuraTurf Fall Winterizer Lawn Food, Phase 4-07/26/2011 Bonide DuraTurf Insect & Feed Summer Phase 3-07/26/2011 Bonide DuraTurf Lawn Seed Starter Fertilizer-01/03/2012 Bonide DuraTurf Premium Lawn Food-07/26/2011 Bonide Weed & Feed Phase 2-07/26/2011 Ferti-lome Classic Lawn Food 16-0-8-01/01/2012 Miracle-Gro Water Soluble Lawn Food, 36-0-6-11/25/2013 Miracle-Gro Watering Can Singles All Purpose Water Soluble Plant Food, 24-8-16-06/05/2013 Schultz Spray Green Weed & Feed Lawn Fertilizer 20-0-0 Schultz Starter Plus Transplanting Solution 5-10-5 Schultz Supreme Green Crabgrass Preventer with Fertilizer 30-3-4 Schultz Supreme Green St. Augustine Weed & Feed with Atrazine 29-3-4 Schultz Supreme Green Starter Fertilizer 18-27-5 Schultz Supreme Green Summer Fertilizer with Insect Control 28-3-8 Schultz Supreme Green Turf Fertilizer with Micronutrients 29-3-4 Schultz Supreme Green Weed & Feed 28-3-3 Schultz Supreme Green Winterizer 22-3-14 Scotts Bonus S Southern Weed & Feed-11/24/2013 Scotts Snap Fall Lawn...
http://hpd.nlm.nih.gov/cgi-bin/household/prodtree?prodcat=Landscape/Yard&purpose=lawn/turf&type=Fertilizer
*  Calories in Kool-Aid Jammers - Juice Drink Green Apple , 10 Pouch | Nutrition and Health Facts
Weight Log Analysis Meals Favorites Recipes Custom Foods. ... Snacks Beverages Meals, Entrees, and Sidedishes. Related ... Calories in Kool-Aid Jammers - Juice Drink Green Apple, 10 Pouch. Overview Food Browser Recipe Browser New Recipe. Calories in Juice Drink Green Apple. Apple Juice. Wondering how many calories are in Juice Drink Green Apple. Manufactured by Kool-Aid Jammers. serving serving grams oz cal. Add to Log Juice Drink Green Apple. Juice Drink Green Apple 10 Pouch -- Grade 90 Calories. Nutrition Facts Serving Size 1 serving 200 g Per Serving % Daily Value* Calories 90 Sodium 25 mg 1 % Carbohydrates 25 g 8 % Sugars 25 g. Juice Drink Green Apple Calories and Health Benefits. Get Nutritional Facts and the Health Benefits for Juice Drink Green Apple. Related Recipes Main Ingredient - Fruits Course - Breakfast Course - Brunch Special Considerations - Vegetarian Banana Milkshake Low-Cal Banana Muffins Apple Crumble Nonfat 'Nana Muffins Vanishing Oatmeal Raisin Cookies Danny's Go Bananas. Hot Banana...
http://caloriecount.com/calories-kool-aid-juice-drink-green-i129645
*  Indonesia | WFP | United Nations World Food Programme - Fighting Hunger Worldwide
for Progress School Meals Centre of Excellence. Our Expertise. ... Indonesia. WFP. United Nations World Food Programme - Fighting Hunger Worldwide. Français Español العربية More. 中文 Dansk Nederlands فارسی Suomi Deutsch Italiano 日本語 한국어 Norsk Русский Svenska. Donate. Search this site:. World Food Programme. Fighting Hunger Worldwide. Executive Director Publications Senior Leadership Partners Corporate Information Ambassadors Funding Careers Mission Statement Contact Strategic Plan. Hunger. What is Hunger. Who are the Hungry. What causes Hunger. What is Malnutrition. Hunger Map Hunger Stats Hunger FAQs Zero Hunger. Our Programmes. Cash and Vouchers Food for Assets HIV / AIDS Purchase for Progress School Meals Centre of Excellence. Preparedness: Being Ready Responding to Emergencies Food Security Analysis: Getting the Facts Procurement: Buying the Food Nutrition: Right Food, Right Time Logistics: Delivering the Food Social Protection and Safety Nets Disaster Risk Reduction Climate Change. Our Operations. Curr...
http://wfp.org/countries/indonesia/media
*  The Truth About Meal Frequency: You Don't Need to Eat Every 2-3 Hours | Von Blanco Fitness
The Truth About Meal Frequency: You Don t Need to Eat Every 2-3 Hours. The Truth About Meal Frequency: You Don t Need to Eat Every 2-3 Hours Posted by. Share the post "The Truth About Meal Frequency: You Don t Need to Eat Every 2-3 Hours" Share on Facebook. Or for someone who s trying to lose fat, doesn t eating 5-6 times a day speed up your metabolism. No matter what you saw on TV, read in magazines, or even heard from fitness gurus, it s all really just a big myth made by supplement companies and magazines. We all have come to believe that eating 6, 7, 8, or 9 meals a day is far superior than just eating anything smaller than 6 meals a day when trying to achieve your ideal physique, when in reality the only actual benefit to eating this many times a day is to supress someone s hunger. In fact, there was a time when I remember eating up to 10 meals a day. You need to consume the macronutrients fats, carbs, and proteins and calories that your body needs, whether it s by eating over your calorie maintenance to...
http://vonblancofitness.com/the-truth-about-meal-frequency-and-nutrient-timing/
*  Effect of Meal Frequency on Insulin Resistance in Subjects With Type 2 Diabetes - Tabular View - Cli
... nicalTrials.gov. Effect of Meal Frequency on Insulin Resistance in Subjects With Type 2 Diabetes This study has been completed. Effect of Meal Frequency on Insulin Resistance in Subjects With Type 2 Diabetes. Effect of Meal Frequency on Insulin Resistance, Insulin Secretion, and Hepatic Fat Content in Subjects With Type 2 Diabetes. two meals daily with the same daily caloric restriction of -500 kcal/day on insulin sensitivity, insulin secretion, and hepatic fat content. two meals daily with the same daily caloric restriction of -500 kcal/day on insulin sensitivity, insulin secretion, and hepatic fat content. Key words Insulin resistance, meal frequency, type 2 diabetes mellitus, non-alcoholic fatty liver disease, adipokines, gut hormones, oxidative stress Methodology Study design: the investigators will use the design of a randomized, crossover study, where 50 individuals with type 2 diabetes will change in a random order the frequency of their meals: six, and two meals a day. For one half of the particip...
https://clinicaltrials.gov/ct2/show/record/NCT01277471
*  Better Blood Glucose with Lower Meal Frequency | Intermittent fasting diet for fat loss, muscle gain
Better Blood Glucose with Lower Meal Frequency. Intermittent fasting diet for fat loss, muscle gain and health. Monday, January 3, 2011. Better Blood Glucose with Lower Meal Frequency. 7:27 PM. Blood Glucose and Meal Frequency. 6 CHO: 65% carbs, 15% protein, 20% fat, split 250 kcal x 6. 3 CHO: 65% carbs, 15% protein, 20% fat, split 500 kcal x 3. I do have a question though, and please excuse my ignorance here: Lower meal frequency leads to lower blood sugar levels insulin works better. My university nutrition professor advised against a high protein diet and when I asked what kind of of a macro-nutrient ratio I should implement into my diet for muscle gain and fat loss, she recommended 60% Carb, 20% protein, 20% fat. Really awesome article, and even if IF was only AS GOOD as 6-meals a day, I would still go for IF... Martin, I don't think a 15-20% protein diet can be considered a low protein diet. Martin, I read somewhere you said carbs are not necessary PWO, that protein alone is useful, but maybe that wa...
http://leangains.com/2011/01/better-blood-glucose-with-lower-meal.html?showComment=1295850598405
*  Better Blood Glucose with Lower Meal Frequency | Intermittent fasting diet for fat loss, muscle gain
Better Blood Glucose with Lower Meal Frequency. Intermittent fasting diet for fat loss, muscle gain and health. Monday, January 3, 2011. Better Blood Glucose with Lower Meal Frequency. 7:27 PM. Blood Glucose and Meal Frequency. 6 CHO: 65% carbs, 15% protein, 20% fat, split 250 kcal x 6. 3 CHO: 65% carbs, 15% protein, 20% fat, split 500 kcal x 3. I do have a question though, and please excuse my ignorance here: Lower meal frequency leads to lower blood sugar levels insulin works better. My university nutrition professor advised against a high protein diet and when I asked what kind of of a macro-nutrient ratio I should implement into my diet for muscle gain and fat loss, she recommended 60% Carb, 20% protein, 20% fat. Really awesome article, and even if IF was only AS GOOD as 6-meals a day, I would still go for IF... Martin, I don't think a 15-20% protein diet can be considered a low protein diet. Martin, I read somewhere you said carbs are not necessary PWO, that protein alone is useful, but maybe that wa...
http://leangains.com/2011/01/better-blood-glucose-with-lower-meal.html?showComment=1296027479777
*  calorie and macro help - AnabolicMinds.com
Weight Loss News. Forum. Nutrition Forum. Weight Loss Forum. Nutrition Forum. Weight Loss Forum. Forum. Nutrition Forum. Im in need of some advice from others to help me though my days. I cant eat 3-4 meals a day for the reason of the fatigue I get eating a big meal,thats why I have a bigger supper as atleast im though work. I cant eat 3-4 meals a day for the reason of the fatigue I get eating a big meal,thats why I have a bigger supper as atleast im though work. Let's assume that we are measuring TEF during 24 hours in a diet of 2700 kcal with 40% protein, 40% carbohydrate and 20% fat. It looked at many different studies that compared TEF during meal frequencies ranging from 1-17 meals and concluded:. Seeing how conclusive and clear research is on the topic of meal frequency, you might wonder why it is that some people, quite often RDs in fact, keep repeating the myth of stoking the metabolic fire by eating small meals on a frequent basis. Those studies likely show that people who tend to eat less frequently...
http://anabolicminds.com/forum/nutrition-health/235298-calorie-macro-help-post4152540.html
*  The New Rules of When vs. What We Eat | Greatist
Greatist. {{item.title}} {{item.title}}. Greatist. But does when we eat really matter, and does the conventional wisdom of more frequent, smaller meals throughout the day still hold up. Share. “Don’t skip breakfast, it’ll make you fat.” “Go more than a few hours without food, and your body will go into starvation mode.” “Stick to six small meals a day.”. A recent study on a small group of Type 2 diabetics suggests two large meals per day can top six mini-meals for weight loss of course, multiple media outlets have already framed the news as though it’s true for the general population. For eight weeks, a small sample of obese adults stuck to either three meals and three snacks a day or just three meals both groups consumed the same amount of calories. The researchers found more meals did not equal greater weight loss. Increased meal frequency does not promote greater weight loss in subjects who were prescribed an 8-week equi-energetic energy-restricted diet. While we burn energy each time we eat the amount of ...
http://greatist.com/health/small-meals-weight-loss-myth-062513
*  .. Foods For Better Vision – Super Foods And Homemade Tips To Increase Eyesight
Foods For Better Vision – Super Foods And Homemade Tips To Increase Eyesight Over the past couple of years we have actually discovered a lot concerning the remarkable part that meals play in combating illness as well as our total health and wellness. Just what we consume impacts the stamina of our body immune system, our capability to eliminate cancer cells as well as various other best carpet cleaners, the wellness of our heart body organs; our psychological quality, the stamina of our teeth bones, the top quality of our rest, the health and wellness of our skin and also hair … it’s difficult to specify them all. Make sure the meals you obtain has lots of top quality healthy protein in it. Below is a basic strategy that not simply enhances eye blood circulation for far better sight, however enhances power degrees in the physical body. Take 5 actions onward strolling on your tippy toes as well as then take 5 actions backwards as you proceed to stroll on your tippy toes. Is it sufficient to obtain healthy and ...
http://courtneyfos.com/
*  The Scott MissionDonate | Scott Mission
The Scott Mission. This website is not optimized for Internet Explorer 6. The Scott Mission Back to Main Site. Meals. Scott Mission. Meals close Bag lunches consist of a drink, sandwich, fruit and snack. This service ensures needy men and women who may not have come to our hot meal service will have something to eat for the day. Bag lunches for 25 people Provide bag lunches for 25 needy men or women. Learn More Item Price: $31. I would like to provide 25 people with bag lunches this number of times. I would like to donate food items. I would like to become a monthly donor. close Bag lunches consist of a drink, sandwich, fruit and snack. This service ensures needy men and women who may not have come to our hot meal service will have something to eat for the day. Bag lunches for 50 people Provide a bag lunch for 50 needy men or women. Learn More Item Price: $63. I would like to provide a bag lunch for 50 this number of times. I would like to become a monthly donor. I would like to become a monthly donor. close ...
https://donate.scottmission.com/?action=view_catalog&Join_ID=196621
*  Psych Central - Family meals cut teenage fatness
... Home Conditions Addictions ADHD Anxiety Panic Autism Bipolar Depression Eating Disorders OCD Parenting Personality Psychotherapy PTSD Relationships Schizophrenia Sleep Stress Something Else... Quizzes News Experts Ask the Therapist Blogs Experts Daily News Research Updates World of Psychology Research Resources Find a clinical Trial Resources Forums Support Groups Find Help Ask the Therapist Drugs Medications Find a Therapist Psychotherapy 101 Forums Support Groups Take a Quiz Mood Tracker Pro. Home Conditions Quizzes Ask the Therapist Drugs Blogs News Research Resources Find Help Psychotherapy 101 Forums Support Groups Pro. Family meals cut teenage fatness. They might prefer to be in front of the TV or Playstation, but Brisbane teenagers are likely to be healthier if they eat meals with mum and dad. Lead researcher, Dr Abdullah Al Mamun from UQ's School of Population Health said regular family meals could reduce snacking and make for healthier food and social habits. The study found having a healthy mat...
http://psychcentral.com/news/archives/2005-11/ra-fmc103105.html
*  PLOS ONE: Effects of Syzygium aromaticum-Derived Triterpenes on Postprandial Blood Glucose in Strept
Article-Level Metrics. Click through the PLOS taxonomy to find articles in your field. View. Sum of PLOS and PubMed Central page views and downloads. Open Access Peer-reviewed Research Article. Published: November 22, 2013 DOI: 10.1371/journal.pone.0081632. Article. The effects of OA/MA on postprandial blood glucose concentration and intestinal carbohydrate-hydrolyzing enzymes and glucose transporters were examined in non-diabetic and STZ-induced diabetic male Sprague-Dawley rats. Western blot analysis of glucose transporters SGLT1 and GLUT2 and carbohydrate hydrolyzing enzymes, α-amylase, α-glucosidase proteins in small intestines isolated from control and treated non-diabetic and STZ-induced diabetic rats were assessed to explore the inhibitory mechanism of OA and MA on glucose absorption. To determine whether these effects also involved intestinal carbohydrate hydrolyzing enzymes, the levels of α-amylase and α-glucosidase were determined using Western blot analysis in small intestines isolated from control...
http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0081632
*  Dietary fatty acids, postprandial lipaemia and coronary heart disease - CentAUR
... . University of Reading CentAUR: Central Archive at the University of Reading. Accessibility navigation Dietary fatty acids, postprandial lipaemia and coronary heart disease. Tools Tools Tools. Wordle Link RDF+XML BibTeX RIOXX2 XML RDF+N-Triples JSON Dublin Core Atom Simple Metadata Refer METS HTML Citation with IDs HTML Citation ASCII Citation OpenURL ContextObject EndNote OpenURL ContextObject in Span MODS MPEG-21 DIDL EP3 XML Dublin Core Reference Manager RDF+N3. Williams, C. M 1999 Dietary fatty acids, postprandial lipaemia and coronary heart disease. In: Tyman, J. P H ed. Lipids in health and nutrition. Royal Society of Chemistry, Cambridge, UK, pp. 65-75. ISBN 9780854047987 Full text not archived in this repository. Item Type: Book or Report Section. Refereed: Yes. Divisions: Faculty of Life Sciences School of Chemistry, Food and Pharmacy Department of Food and Nutritional Sciences Human Nutrition Research Group Interdisciplinary centres and themes Institute for Cardiovascular and Metabolic Researc...
http://centaur.reading.ac.uk/19551/
*  Nutrition Journal | Abstract | Effect of a walnut meal on postprandial oxidative stress and antioxid
nutrition journal abstract effect of a walnut meal on postprandial oxidative stress and antioxidants in healthy individuals nutritionj com article bottom top biomed central journals gateways search nutrition journal biomed central for go advanced search home articles authors reviewers about this journal my nutrition journal nutrition journal volume viewing options abstract full text pdf kb additional files associated material pubmed record article metrics open badges readers comments pre publication history related literature cited by google blog search other articles by authors on google scholar haddad eh gaban chong n oda k sabaté j on pubmed haddad eh gaban chong n oda k sabaté j related articles pages on google on google scholar on pubmed tools download references download xml order reprints post a comment download to papers mendeley download to papers mendeley share this article tweet more options citeulike linkedin del icio us email...
http://nutritionj.com/content/13/1/4/abstract
*  High Blood Sugar After Meals And What To Do About It
... Secondary menu Skip to primary content Skip to secondary content Search for:. Subscribe. About Us Contributors Contact. The Diabetes Magazine. Home. Features. Diabetes. Type 1 Diabetes. Type 2 Diabetes. Type 2 Diabetes Treatments. Gestational Diabetes Tips. Recipes. Blogs. News. Books. A Sweet Life. Blogs. Blood Sugar Control. High Blood Sugar After Meals And What To Do About It High Blood Sugar After Meals And What To Do About It Catherine Price. August 13, 2013 Category: Blood Sugar Control. 8 84. 0. 1. I will admit to having a bit of a diabetes crush on Gary Scheiner, MS, CDE, Type 1, and founder of Integrated Diabetes Services, LLC. And you know what. I m not the only one.. I recently saw Gary give a talk called Strike the Spike at the American Association of Diabetes Educators AADE 2013 conference to a room packed with diabetes educators. The point was to help CDEs understand why managing/avoiding post-meal blood glucose spikes is important and to learn new techniques for how to do so.. I was there ...
http://asweetlife.org/catherine/blogs/blood-sugar-control-blogs/high-blood-sugar-after-meals-and-what-to-do-about-them/33736/
*  The Old Reader
It even made an appearance on Criminal Minds last week sorry New Zealand TV is probably months out of date … and yes, there is an ever growing number of studies that indicate that people who sit for long periods are at greater risk of developing, and dying from cardiovascular disease, diabetes and cancer. There are also studies that indicate that people’s pattern of sitting might also affect their risk of diabetes and cardiovascular disease longer periods of interrupted sitting are worse than short bouts that are regularly interrupted with activity . However, the vast majority of these studies are observational in nature, meaning that they can’t tell us if changing peoples sitting patterns will actually reduce their risk of developing and dying from the above mentioned diseases. So that is where our study comes in… we decided to investigate whether different patterns of activity and sitting would affect risk factors for cardiovascular disease in a very acute setting. Specifically, our study was designed to co...
https://theoldreader.com/profile/514503c454cf825a2500005e
*  PLOS ONE: Measurement of Ad Libitum Food Intake, Physical Activity, and Sedentary Time in Response t
... o Overfeeding. Article-Level Metrics. View. Sum of PLOS and PubMed Central page views and downloads. Open Access Peer-reviewed Research Article. Measurement of Ad Libitum Food Intake, Physical Activity, and Sedentary Time in Response to Overfeeding. Published: May 22, 2012 DOI: 10.1371/journal.pone.0036225. Article. We hypothesized a down-regulation in subsequent food intake and sedentary time, and up-regulation in non-exercise activity and core temperature in response to overfeeding in order to maintain body weight constant. Following the 3 days of ad libitum food intake, volunteers resumed their weight maintaining diet for 3 days as a wash out period followed by another 3 days of either the WM or OF diet and once again followed by 3 days of ad libitum food intake using the vending machines. Following the 3 days of ad libitum food intake, volunteers resumed their weight maintaining diet for 3 days as a wash out period followed by another 3 days of either the WM or OF diet and once again followed by 3 day...
http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0036225
*  ARS Project: Dietary and Lifestyle Factors Affecting Food Intake and Energy Metabolism in Lean and O
... verweight Individuals 420907 Annual Report Food Components and Health Laboratory : Research. Page Banner. United States Department of Agriculture Agricultural Research Service. ARS Home. About ARS. Contact Us. Search for This. ARS Research. Research Home. National Programs. Research Projects. Scientific Manuscripts. International Programs. Trending Research Topics. Scientific Software/Models. Databases & Datasets. Scientific Collaborations. ARS People Locations. Find a person. Find a location. Find an office at headquarters. Organizational chart. Administrator’s Council. ARS Newsroom. News Home. Latest News. Magazine. Photos. Subscription Lists. Briefing Room. Podcasts. Events. Press Room. Video. ARS Careers. ARS Vacancies at USAJOBS. Careers at ARS Info. Post Doctoral Positions. . Site Map. A-Z Index. Help. . You are here: Northeast Area Home / Food Components and Health Laboratory / Research / Research Project #420907. Related Topics Project Team Rumpler, William. Project Annual Reports 2014. 2013. 2012...
http://ars.usda.gov/research/projects/projects.htm?ACCN_NO=420907&fy=2011
*  Phytogenics
'Phytogenics' are a group of natural growth promoter s NGPs or non-antibiotic growth promoters used as feed additive s, derived from herbs, spices or other plants. They are commonly regarded as favorable alternatives to antibiotic growth promoters AGPs in livestock production. 1 Benefits of phytogenics Modes of action Effect on feed intake. Effect on gut microflora. Effect on growth rates. Effect on ammonia emissions. Production of Phytogenics References Further reading External links. Benefits of phytogenics. The potential benefits of using phytogenics in livestock nutrition are:. increased feed intake stimulation of digestion increased growth performance reduced incidence of diarrhea increased performance parameters improved reproductive parameters improved feed efficiency higher profitability. Modes of action. Effect on feed intake. Effect on gut microflora. A well-balanced gut microflora is necessary to protect the gut from pathogenic invasion. At the best, a beneficial combination of different phytogenic...
https://en.wikipedia.org/wiki/Phytogenics
*  Normal food at will and nil-by-mouth enteral feeding after major upper GI surgery did not differ for
normal food at will and nil by mouth enteral feeding after major upper gi surgery did not differ for mortality or morbidity evidence based nursing...
http://ebn.bmj.com/content/12/1/21.full.pdf html?frame=header
*  Now Foods Supplements product listing - Shop lowest prices for Brand Supplements
Order 1-800-338-7979 24-hrs. Brand > Now Foods > Supplements Supplements Alphabetical Product List 7-Keto 100 Mg by Now Foods 7-Keto 25 Mg by Now Foods Acacia Fiber by Now Foods Acai Powder Organic by Now Foods Aloe Vera Gels by Now Foods Amino Complete by Now Foods Artichoke Extract 450 Mg by Now Foods Astaxanthin 10 Mg by Now Foods Astaxanthin 4 Mg by Now Foods Beef Gelatin Hydrolyzed 550 Mg by Now Foods Beta Sitosterol Plant Sterols by Now Foods Beta-Alanine 100% Pure Powder by Now Foods Beta-Alanine 750 Mg by Now Foods Biotin 5,000 Mcg by Now Foods Blood Pressure Health by Now Foods Brain Elevate by Now Foods Brewer's Yeast 650 Mg by Now Foods Calcium Hydroxyapatite Caps by Now Foods Caprylic Acid 600 Mg by Now Foods Coconut Oil Virgin 1,000 Mg by Now Foods CoQ10 100 Mg with Hawthorn by Now Foods CoQ10 60 Mg with Omega-3 Fish Oil by Now Foods Curcumin Phytosome by Now Foods Cycle Comfort by Now Foods DHA-500 by Now Foods D-Mannose Powder by Now Foods Dopa Mucuna by Now Foods Elderberry Liquid 500 Mg by No...
http://nutritionexpress.com/now foods/supplements
*  Now Foods Supplements product listing - Shop lowest prices for Brand Supplements
Order 1-800-338-7979 24-hrs. Brand > Now Foods > Supplements Supplements Alphabetical Product List 7-Keto 100 Mg by Now Foods 7-Keto 25 Mg by Now Foods Acacia Fiber by Now Foods Acai Powder Organic by Now Foods Aloe Vera Gels by Now Foods Amino Complete by Now Foods Artichoke Extract 450 Mg by Now Foods Astaxanthin 10 Mg by Now Foods Astaxanthin 4 Mg by Now Foods Beef Gelatin Hydrolyzed 550 Mg by Now Foods Beta Sitosterol Plant Sterols by Now Foods Beta-Alanine 100% Pure Powder by Now Foods Beta-Alanine 750 Mg by Now Foods Biotin 5,000 Mcg by Now Foods Blood Pressure Health by Now Foods Brain Elevate by Now Foods Brewer's Yeast 650 Mg by Now Foods Calcium Hydroxyapatite Caps by Now Foods Caprylic Acid 600 Mg by Now Foods Coconut Oil Virgin 1,000 Mg by Now Foods CoQ10 100 Mg with Hawthorn by Now Foods CoQ10 60 Mg with Omega-3 Fish Oil by Now Foods Curcumin Phytosome by Now Foods Cycle Comfort by Now Foods DHA-500 by Now Foods D-Mannose Powder by Now Foods Dopa Mucuna by Now Foods Elderberry Liquid 500 Mg by No...
http://nutritionexpress.com/now foods/supplements/now coq10 100 mg with hawthorn 90 capsules.aspx
*  Now Foods Supplements product listing - Shop lowest prices for Brand Supplements
Order 1-800-338-7979 24-hrs. Brand > Now Foods > Supplements Supplements Alphabetical Product List 7-Keto 100 Mg by Now Foods 7-Keto 25 Mg by Now Foods Acacia Fiber by Now Foods Acai Powder Organic by Now Foods Aloe Vera Gels by Now Foods Amino Complete by Now Foods Artichoke Extract 450 Mg by Now Foods Astaxanthin 10 Mg by Now Foods Astaxanthin 4 Mg by Now Foods Beef Gelatin Hydrolyzed 550 Mg by Now Foods Beta Sitosterol Plant Sterols by Now Foods Beta-Alanine 100% Pure Powder by Now Foods Beta-Alanine 750 Mg by Now Foods Biotin 5,000 Mcg by Now Foods Blood Pressure Health by Now Foods Brain Elevate by Now Foods Brewer's Yeast 650 Mg by Now Foods Calcium Hydroxyapatite Caps by Now Foods Caprylic Acid 600 Mg by Now Foods Coconut Oil Virgin 1,000 Mg by Now Foods CoQ10 100 Mg with Hawthorn by Now Foods CoQ10 60 Mg with Omega-3 Fish Oil by Now Foods Curcumin Phytosome by Now Foods Cycle Comfort by Now Foods DHA-500 by Now Foods D-Mannose Powder by Now Foods Dopa Mucuna by Now Foods Elderberry Liquid 500 Mg by No...
http://nutritionexpress.com/now foods/supplements/now elderberry liquid 500 mg 8 fluid ounces.aspx
*  Now Foods Supplements product listing - Shop lowest prices for Brand Supplements
Order 1-800-338-7979 24-hrs. Brand > Now Foods > Supplements Supplements Alphabetical Product List 7-Keto 100 Mg by Now Foods 7-Keto 25 Mg by Now Foods Acacia Fiber by Now Foods Acai Powder Organic by Now Foods Aloe Vera Gels by Now Foods Amino Complete by Now Foods Artichoke Extract 450 Mg by Now Foods Astaxanthin 10 Mg by Now Foods Astaxanthin 4 Mg by Now Foods Beef Gelatin Hydrolyzed 550 Mg by Now Foods Beta Sitosterol Plant Sterols by Now Foods Beta-Alanine 100% Pure Powder by Now Foods Beta-Alanine 750 Mg by Now Foods Biotin 5,000 Mcg by Now Foods Blood Pressure Health by Now Foods Brain Elevate by Now Foods Brewer's Yeast 650 Mg by Now Foods Calcium Hydroxyapatite Caps by Now Foods Caprylic Acid 600 Mg by Now Foods Coconut Oil Virgin 1,000 Mg by Now Foods CoQ10 100 Mg with Hawthorn by Now Foods CoQ10 60 Mg with Omega-3 Fish Oil by Now Foods Curcumin Phytosome by Now Foods Cycle Comfort by Now Foods DHA-500 by Now Foods D-Mannose Powder by Now Foods Dopa Mucuna by Now Foods Elderberry Liquid 500 Mg by No...
http://nutritionexpress.com/now foods/supplements/now gaba 500 mg 100 capsules.aspx
*  Top Paw® Pet Food Can Cover | Storage & Scoops | PetSmart
Top Paw® Pet Food Can Cover. Storage & Scoops. PetSmart. shop. PetPerks. Store Locator. Welcome to PetSmart. Dog. View all. Food Health. Food. Supplies Training. Bowls Feeders. Grooming Supplies. Pet Memorials. Stain Odor Removers. Toys. Featured Shops. New Puppy Center. Featured Shops. Halloween Shop. Food Center. Puppy Center. Sale. Dog. Cat. Cat. View all. Food Health. Food. Supplies Training. Bowls Feeders. Books. Grooming Supplies. Pet Memorials. Stain Odor Removers. Toys. Featured Shops. Featured Shops. Halloween Shop. Food Center. Sale. Fish. Fish. View all. Food Care. Food. Saltwater Aquarium Care. Water Care Conditioning. Supplies. Books. Free Shipping on Orders of $49+ or Free Store Pickup where available Learn more. Make sure your dog's or cat's canned food remains fresh with this can cover. Seal and store your pet's food to keep it fresh longer with the Top Paw Pet Food Can Cover. The cover is made from silicone for durability, and is sized to fit 3 different can sizes to ensure your dog's or cat'...
http://petsmart.com/gsi/webstore/WFS/PETNA-PETUS-Site/en_US/-/USD/ViewProduct-Start;pgid=wapeef9OpNlSRpTcGB5iOtCt0000eSU8gVyX?SKU=36-6891
*  Prison Planet.com » Ethanol Mandates Plague Developing Countries With Rising Food Prices
Prison Planet.com Ethanol Mandates Plague Developing Countries With Rising Food Prices. Home Alex Jones Radio Show Listening Info. Social Alex Jones Twitter. Alex Jones Facebook. News Science And Technology Ethanol Mandates Plague Developing Countries With Rising Food Prices. oil production, prompted by government mandates that require the use of biofuel in gasoline, is escalating the price of corn while plaguing poor countries with rising food prices. Critics worldwide are now questioning the federal government’s ethanol mandates, as the use of American-produced corn for biofuel has added more than $6.5 billion to the food import bills of developing countries, particularly in North Africa and Central America. Corn Ethanol Expansion, indicates that federal requirements that mandate the inclusion of ethanol in gasoline have imposed a significant burden on corn-importing countries. Higher corn prices have had a direct impact on the food-import bills of developing countries, many of which have become heavily dep...
http://prisonplanet.com/ethanol-mandates-plague-developing-countries-with-rising-food-prices.html
*  “What Do Rising Food Prices Mean?” | DipNote
“What Do Rising Food Prices Mean?”. Menu toggle. Search toggle. Search toggle. Search. Stories. Socials. “What Do Rising Food Prices Mean?”. February 23, 2011. Hormats serves as Under Secretary of State for Economic, Energy and Agricultural Affairs. The United Nation's Food and Agricultural Organization released figures this month showing that global food prices have risen 41 percent since June, primarily due to a combination of bad weather and an increase in global demand. In response to that crisis, the international community, led by the G-8, committed to increase focus on food security and reverse the decade-long decline in assistance for agricultural development. Global food security is a top priority for the United States. We are closely watching food prices and their impact on the poor, we are coordinating closely with other governments and international organizations, and we are taking steps to achieve long-term sustainable solutions to food insecurity. World food prices have been increasing over the ...
http://blogs.state.gov/stories/2011/02/23/what-do-rising-food-prices-mean?page=0,1632
*  Changes in food expenditures, 1969--73: findings from the retirement history study.
... BioMedSearch. Advanced Search. Tools. Search Tutorial. Login. Document Detail. Changes in food expenditures, 1969--73: findings from the retirement history study. MedLine Citation:. PMID: 684554 Owner: NLM Status: MEDLINE. Abstract/OtherAbstract:. From 1969 to 1973, average expenditures for food at home reported by Retirement History Study respondents increased by almost the same proportion--30 percent--as did the food component of the consumer price index. Changes in these expenditures were not very responsive to changes in income, but income had greater power in explaining total food expenditures. The analysis was based largely on a regression technique that identifies the factors most important in explaining the variation in food expenditures. Size of household was the most important predictor of both the total level of household food expenditures and the per person level. With size of household and income taken into account, a number of socioeconomic variables--including race, sex, age, morale, healt...
http://biomedsearch.com/nih/Changes-in-food-expenditures-1969/684554.html
*  Whisker City® Pet Food Can Cover | Storage & Scoops | PetSmart
Whisker City® Pet Food Can Cover. PetSmart. PetPerks. Store Locator. Welcome to PetSmart. Dog. View all. Food Health. Food. Supplies Training. Bowls Feeders. Grooming Supplies. Pet Memorials. Stain Odor Removers. Featured Shops. New Puppy Center. Featured Shops. Food Center. Puppy Center. Sale. Dog. Cat. Cat. View all. Food Health. Food. Supplies Training. Bowls Feeders. Books. Grooming Supplies. Pet Memorials. Stain Odor Removers. Featured Shops. Featured Shops. Food Center. Sale. Fish. Fish. View all. Food Care. Food. Water Care Conditioning. Supplies. Books. Free Shipping on Orders of $49+ or Free Store Pickup where available Learn more. Delivery of Your Item s The delivery date of your order depends on when the order leaves our warehouse, the destination address for the item and the shipping method. An Estimated Delivery Date is a calculation of several factors, including item availability, processing time in our warehouse, the shipping method you select and the shipping destination. Make sure your pet's ...
http://petsmart.com/gsi/webstore/WFS/PETNA-PETUS-Site/en_US/-/USD/ViewProduct-Start;pgid=wapeef9OpNlSRpTcGB5iOtCt0000eSU8gVyX?SKU=36-6202
*  NunatsiaqOnline 2013-03-04: COMMENTARY: What really happened to food costs under Nutrition North?
NunatsiaqOnline 2013-03-04: COMMENTARY: What really happened to food costs under Nutrition North. COMMENTARY: Around the Arctic March 04, 2013 - 8:00 am What really happened to food costs under Nutrition North. "Cheerleaders for this program have been using smoke and mirrors in the way food cost information is collected" SPECIAL TO NUNATSIAQ NEWS This graph shows that by September 2011, the cost of a revised northern food basket had spiked dramatically. By September 2012, the cost fell to a level comparable to 2010, but only because AAND pumped more money into the program and raised subsidies to a point that exceeded those used in the food mail program. FRED HILL AND MICHAEL FITZGERALD In May 2010, the Government of Canada announced that the Food Mail Program would be replaced by Nutrition North Canada and that the new program would make healthy food more accessible and affordable to Canadians living in isolated Northern communities. Since late 2011, claims that Nutrition North Canada subsidies are reducing t...
http://nunatsiaqonline.ca/stories/article/65674what_really_happened_to_food_costs_under_nutrition_north/
*  GSFA Online Food Categories
... GSFA Online. Food Categories. The Codex GSFA's food category system is hierarchical and applies to all foodstuffs, including those in which no food additives are permitted. The system includes a description of the foods covered by each food category, as well as relevant food additive provisions. Click on a category below to view its description and relevant food additive provisions. Food categories marked with this symbol may contain one or more subcategories listed in the Annex to Table 3. Table 3 provisions therefore apply only to some, but not all of the subcategories of the indicated category. Table 3 provisions do not apply to categories marked with this symbol as they are listed in the Annex to Table 3. Expand All - Click to show the entire food category hierarchy on one page for printing or online reference. Click + to expand the list and view foods under a category. Food Category. Dairy products and analogues, excluding products of category 02.0. Cereals and cereal products, derived from cereal g...
http://codexalimentarius.net/gsfaonline/foods/index.html?id=181
*  Sinus and Food: How Food Can Affect the Sinuses
... Site Map. About. mysinustory.com. Sinus Congestion. Pressure Relief. Colds Flu. Mucus Color. Mucus Color. Green Mucus. Yellow Mucus. Sinus and Food: How Food Can Affect the Sinuses. H aving sinus pressure, drainage or just plain excessive mucus. Have you wonder how some of the foods you eat may be impacting your sinus issues. These are questions many people have been asking which deserve an answer. Mucus and Food There is such thing as a "good kind of mucus." It is produced to help our respiratory organs carry on their work efficiently. This kind of mucus is being produced all the time by the membranes lining the sinus cavity. Yet when it becomes excessive it is annoying and we wish to do something about it. At this point some begin to think about the possible connection between mucus and food. From the outset we can say: The connection is more real and verifiable than many realize. The excessive mucus can irritate the sinus cavity and nasal cavity and cause infection in those organs' membranes, especial...
http://mysinustory.com/sinusandfood.html
*  GSFA Online Food Categories
... GSFA Online. Updated up to the 38 th Session of the Codex Alimentarius Commission 2015. Food Categories. The Codex GSFA's food category system is hierarchical and applies to all foodstuffs, including those in which no food additives are permitted. The system includes a description of the foods covered by each food category, as well as relevant food additive provisions. The food categories are not intended for labeling purposes. Click on a category below to view its description and relevant food additive provisions. Food categories marked with this symbol may contain one or more subcategories listed in the Annex to Table 3. Table 3 provisions therefore apply only to some, but not all of the subcategories of the indicated category. Table 3 provisions do not apply to categories marked with this symbol as they are listed in the Annex to Table 3. Expand All - Click to show the entire food category hierarchy on one page for printing or online reference. Complete list may take a while to download on slower conn...
http://codexalimentarius.net/gsfaonline/foods/index.html?id=51&collapse=59
*  John Lott's Website: New Op-ed up at Fox News: Ethanol Mandates Cause Rising Food Prices
... John Lott's Website. Welcome. Follow me on twitter at @johnrlottjr. Please e-mail questions to johnrlott@crimeresearch.org. 4/28/2008 New Op-ed up at Fox News: Ethanol Mandates Cause Rising Food Prices. You can read the new piece here : Food prices are rising worldwide. Some nations, such as Egypt and Cameroon, are facing riots as the prices for basic food stuffs rise. Other countries from India to Cambodia have banned food exports to try and keep prices low and reduce voter anger. In the U.S., the Wall Street Journal last week gave advice normally associated with survivalists warning about the end of civilization. Readers were warned to start hoarding non-perishables "Dried pasta, rice, cereals, and cans of everything from tuna fish to fruit and vegetables". But in case anyone missed the seriousness of the message, the Journal went so far as to give the extra advice that: "You should also save money by buying them in bulk." Not all food prices are soaring, however. Food and beverages as a group aren’t r...
http://johnrlott.blogspot.com/2008/04/new-op-ed-up-at-fox-news-ethanol.html
*  Retail food prices rise in first quarter of 2008 | [primary-term] content from Delta Farm Press
Retail food prices rise in first quarter of 2008. Home Cotton Soybeans Corn Rice Wheat Peanuts Livestock Markets Government Management Equipment Weather. Home > Retail food prices rise in first quarter of 2008 Retail food prices rise in first quarter of 2008 Apr 1, 2008 Delta Farm Press. retail food prices at the supermarket increased in the first quarter of 2008, according to the latest American Farm Bureau Federation Market Basket Survey. A 5-pound bag of flour showed the largest retail price increase, up 69 cents to $2.39. Other items that increased in price were: cheddar cheese, up 61 cents to $4.71 per pound; corn oil, up 58 cents to $3.01 per 32-ounce bottle; a dozen large eggs, up 55 cents to $2.16; vegetable oil, up 38 cents to $2.63 per 32-ounce bottle; mayonnaise, up 22 cents to $3.14 for a 32-ounce jar; Russet potatoes, up 18 cents to $2.47 for a 5-pound bag; a 20-ounce loaf of white bread, up 16 cents to $1.78; apples, up 13 cents to $1.40 per pound; whole fryer chickens, up 9 cents to $1.37 p...
http://deltafarmpress.com/retail-food-prices-rise-first-quarter-2008
*  .. Food Pyramid Illustrates How Foods Rise In Toxicity As They Become More Processed .. Udo’s Cho
Food Pyramid Illustrates How Foods Rise In Toxicity As They Become More Processed By Waking Times September 13, 2013. Food Pyramid Illustrates How Foods Rise In Toxicity As They Become More Processed. Mae Chan, Prevent Disease Waking Times. A food processing pyramid designed by Udo Erasmus perfectly illustrates how processed foods rise in toxicity and potential health dangers as we move from the bottom, based on raw foods, to the top of the pyramid based on hydrogenated, superheated toxic foods which promote disease. Approximately 70% of all calories in the western diet come from a combination of the following four foods: wheat, dairy, soy  and corn  – assuming, that is, we exclude calories from sugar. Then there’s dairy. Actually, with the exception of sugar, soy and wheat are the two most destructive nutrients affecting weight and health in the entire world. As we move away from raw foods and progress to ultra processed foods, shelf life increases and so does disease. 1st Level – RAW FOODS. The base ...
http://wakingtimes.com/2013/09/13/food-pyramid-illustrates-foods-rise-toxicity-become-processed/
*  Buy NOW Foods Food Products and Save | Page 3
Buy NOW Foods Food Products and Save. Favorites. Help. web vitamins. Live Healthy. Look Healthy. Free Shipping over $49.*. 1 800 919 9122 Live Chat. Since 1997 Brand Index :. All Products. Vitamins. Supplements. Targeted Formulas. Health & Personal Care. Diet, Nutritional Foods & Exercise. Teas & Accessories. Herbs. Children's Products. Baby Care. Homeopathy. Pet Products. My Favorites. Sign up for health news and exclusive discounts. Your cart is empty. - full-screen cart -. Customer Reviews. Featured Brands Nature's Way. Country Life. Ortho Molecular Products. Jarrow Formulas. Born Free. NOW Foods. Montague's Brands. Category. Diet, Nutritional Foods & Exercise 131. Health & Personal Care 2. Herbs 3. Targeted Formulas 5. Vitamins & Supplements 9. Brand. NOW Foods 4. NOW Foods Food Products 167. Bag 54. Food 131. Powder 26. Syrup 4. Tablet 1. VegiCap 1. Dietary Need. Dairy Free 6. Gluten Free 35. Kosher 22. Organic 21. Vegetarian 47. . NOW Foods Food Products In:. All Products. Order By Product Name Brand Na...
http://webvitamins.com/now-foods-food-products/3
*  Types of food poisoning - A guide to Food poisoning
... Types of food poisoning. Food poisoning is caused by food and water which has become infected by bacteria, or viruses, parasites or toxins. This results in different types of food poisoning although they share the same symptoms, for example abdominal pain, vomiting and diarrhoea. So what are the most common types of food poisoning. Chicken food poisoning appears to be the most well known type of food poisoning but there are several others which are discussed within this section of the guide. Chicken food poisoning. Beef food poisoning. Pork food poisoning. Fish food poisoning. Bacterial food poisoning. Viral food poisoning. Parasites. Toxins The bacterial and viral food poisoning sections contain individual subsections which discuss these in more detail. For example, there is a subsection about E coli bacteria. Chicken, beef, pork and fish food poisoning are all caused by different strains of bacteria. However, fish can also be infected by parasites or toxins found within seawater which build up inside. ...
http://medic8.com/healthguide/food-poisoning/types-of-food-poisoning.html
*  5000 Plus Food Facts | Belly Bytes
5000 Plus Food Facts. Belly Bytes. Home > 5000 Plus Food Facts. Recipes. Beef Recipes Beverage Recipes Bread Recipes Breakfast Recipes Cake Recipes Chicken Recipes Chocolate Citrus Recipes Cookies Bars Desserts Sweets MUCH More... Fab Foods. Acai Berry Acerola Almonds Apricots Artichokes Arugula Asparagus Avocados Bananas Barley Beans SO MUCH MORE... Food Facts. Bytes 'n Busters. Belly Bytes. Belly Busters. Fat Busters. Belly Bytes. 5000 Plus Food Facts. Food Categories and Specific Foods. Below we have the categorized food facts on the left and the specific foods on the right. Tons of food facts, tidbits, history, etc. Beverage Facts Bread and Muffin Facts Cake, Pie and Cookie Facts Cheese Facts. Chewing the Fat Facts Coffee and Tea Facts. Consumer Awareness Food Facts. Dairy Food Facts Food Additive Facts. Fast Food Facts Fat Facts Food Canning Facts Food Safety Facts Fowl Food Facts Freshwater Fish Food Facts Frosting and Topping Food Facts. Frozen Food Facts Grain Food Facts. Pasta Shapes. Herb and Sp...
http://bellybytes.com/foodfacts/
*  Healthy food no more costly than junk food, government finds – USATODAY.com
... USA TODAY. Healthy food no more costly than junk food, government finds. Reprints Permissions. Contrary to popular belief, many healthy foods are no more expensive than junk food, according to a large new government analysis. "Price is not a good excuse" for not eating a nutritious diet, says Andrea Carlson, who studies food prices and food consumption with an emphasis on healthy diets. "Price is not a good excuse" for not eating a nutritious diet, says Andrea Carlson, who studies food prices and food consumption with an emphasis on healthy diets. "We have all heard that eating a healthy diet is expensive, and people have used that as an excuse for not eating a healthy diet, … but healthy foods do not necessarily cost more than less healthy foods," says Andrea Carlson, an economist and co-author of the report from the U.S. Some of the least expensive foods and beverages by portion size:. Carlson and and her colleague Elizabeth Frazão gathered national pricing data on more than 4,000 foods and then ranked...
http://usatoday30.usatoday.com/news/health/story/2012-05-17/healthy-food-cost-USDA/55018070/1
*  Food | Toddler Tip of the Day
Tags: food. Category: food. Leave a comment. Tags: eating out with toddler, food. Category: food. Leave a comment. Tags: food, Parenting, toddler. Category: food. Leave a comment. Tags: food, Parenting, safety, toddler. Category: danger, food, safety. Leave a comment. Tags: baby, clean up, food, Parenting, toddler. Category: baby, food, toddler. Leave a comment. Eating out with toddlers. Tags: eating out, family, food, Parenting, toddler. Category: food, Parenting. Leave a comment. Milk for babies, toddlers and kids. Best choice of milk for children after age 1 is whole milk. Tags: diet, food, Parenting, toddler. Category: diet, food. Leave a comment. Emotional attachment to food. Toddlers develop an emotional attachment to food. Do not overfeed your toddler with snackfoods and other unhealthy foods. Tags: diet, emotional attachment, food, toddler. Category: diet, food, toddler. Leave a comment. Tags: dessert, food, temperament, toddler. Category: food, temperment. Leave a comment. Tags: diet, food. Category:...
http://lil-fingers.com/wordpress/?cat=31
*  How Food is Converted to Energy in our body
... Menu. Home. Education. SCIENCE. Biology. Analysis-Assay. Biotechnology. Physics. Chemistry. Careers. Scholarships. Study Skills. About. Store. How Food is Converted to Energy in our Body. Food is a vital necessity for us to live and of course we all of us strive to achieve our food everyday. But why food is necessary. because we are hungry. Ya of-course and why we are hungry is because it is a bodies call to replenish or restore the reserve food inside body as it is ready to use it for supply of energy. So what we ate previously gives us energy now and what we eat now gives us energy in the next requirement of the body. But body has a very alert mechanism to use the food resources very scarcely so as to survive in times we don t provide it with food. When we eat food, it releases into the blood the reserve supply of glucose in the liver to provide energy to the body. But in case we don t have food, it releases very scarcely and hence we feel weak and lethargic. freedigitalphotos.net: dane. But how food i...
http://rajaha.com/food-converted-energy-body/
*  US food prices increasing sharply
Miss Philicia Member. Posts: 24,793 celebrity poster, faker poser. Re: US food prices increasing sharply Reply #4 on: March 09, 2008, 12:26:08 PM. Re: US food prices increasing sharply Reply #5 on: March 09, 2008, 12:46:46 PM. Re: US food prices increasing sharply Reply #6 on: March 09, 2008, 01:00:55 PM. Re: US food prices increasing sharply Reply #7 on: March 09, 2008, 01:08:58 PM. Re: US food prices increasing sharply Reply #9 on: March 09, 2008, 01:15:25 PM. Logged 5/06 VL 1M+, CD4 22, 5%, pneumonia, thrush -- O2 support 2 months, 6/06 +Kaletra/Truvada 9/06 VL 3959 CD4 297 13.5% 12/06 VL 400 CD4 350 15.2% +Pravachol 2007 VL 400, 70, 50 CD4 408-729 16.0% -19.7% 2008 VL UD CD4 468 - 538 16.7% - 24.6% Osteoporosis 11/08 doubled Pravachol, +Calcium/D 02/09 VL 100 CD4 616 23.7% 03/09 VL 130 5/09 VL 100 CD4 540 28.4% +Actonel osteoporosis 7/09 VL 130 8/09 new regimen Isentress/Epzicom 9/09 VL UD CD4 621 32.7% 11/09 VL UD CD4 607 26.4% swap Isentress for Prezista/Norvir 12/09 liver and muscle issues VL 50 2010 V...
http://forums.poz.com/index.php?topic=19545.msg249391
*  Food Poisoning as related to Nutrition
... Home > Treatments > N > Nutrition Products. Food Poisoning. Nutrition. Treatments. Nutrition. Food Poisoning. Nutrition. Foodborne illness or food poisoning is caused by consuming food contaminated with pathogenic bacteria, toxins, viruses, prions or parasites. To give the body proper nutrition, a person has to eat and drink enough of the foods that contain key nutrients. Food Poisoning as related to Nutrition. Food Poisoning: Facts on Remedies for Treatment Food poisoning is an illness caused by eating or drinking food or water contaminated with viruses, bacteria, toxins, parasites, or chemicals. Food Poisoning Symptoms and Treatment - MedicineNet Food poisoning is a food borne disease. Food Poisoning - definition of Food Poisoning by … Food Poisoning Definition. Food poisoning is a general term for health problems arising from eating contaminated food. Food may be contaminated by bacteria, viruses ... Food Poisoning Causes, Symptoms, Treatment - When … In the majority of individuals with mild to modera...
http://goldbamboo.com/relate-tl1339-tr1578.html
*  .. Food Fun & News .. Popular in Food Fun & News .. Watch This .. Top Topics .. 13 Foods Worth Tryi
Food. Food Fun News. 13 Foods Worth Trying at a Greek Restaurant. Accessories for the Perfect Lunch. Lunch Outside the Box: Pack the Perfect Meal. Calorie Count of Your 10 Favorite Fair Foods. One of the best parts of heading to your county or state fairs is the amazing food selection. Popular in Food Fun News. 5 Foods You’re Spoiling By Putting In the Refrigerator. 10 Ordinary Kitchen Tools and Their Brilliant Uses You Never Thought Of. Ice Cube Tray Hacks: 9 Genius Ways You Never Thought to Use Them. Spend Less Money on Groceries: 19 Tricks Frugal Shoppers Use. Skip the Greens: 6 Healthy and Trendy Black Foods. 5 Tips to Reduce Food Waste. 5 Things You Probably Didn’t Know About Food Safety. More than 3,000 … Read More. 3 Eating Habits to Minimize Your Ecological Footprint. Here are 7 tips on how to keep your … Read More. Quick Tips for Planning the Perfect Dinner Party. Dinner Party Tip #1: Don’t get too creative. Poison Ivy Remedies Knock-Knock Jokes How to Lose Weight Ant Repellant Apple Cider Vinegar D...
http://rd.com/food/fun/page/7/
*  Dog & Puppy Food Reviews of 2014 & 2015 at Review Centre
Dog Puppy Food Reviews of 2014 2015 at Review Centre. Dog Puppy Food. Introduction At Review Centre we provide you with dog food reviews written by dog owners themselves so that you can compare the various brands of pet food such as Pedigree, Frolic and Bakers. Once you have made your purchases, write some dog food reviews of your own so that your experience can be of help to other consumers in choosing the best dog foods. Refine Your Search Please select Brand see more Pedigree. Bakers. Asda. Eukanuba. Iams. Nutrience. Wagg. Butchers. Chappie. James Wellbeloved. Laughing Dog. Pets at Home. Purina. Skinners. Tesco. Arden. Benningtons. Dick Van Pattern. Flint River Ranch. Frolic. Hi Life. Kong. OrganiPets. Pal. Pascoes. Squires & Beaumont. Vitalin. Other. Minimum Star Rating. View results with any rating. Sort by. Date Added: Ascending Date Added: Descending Alphabetical: Ascending Alphabetical: Descending Last Reviewed: Latest First Last Reviewed: Earliest First Star Rating: High to Low Star Rating: Low to Hi...
http://reviewcentre.com/products3470.html?rating=1
*  Manufacturer price pressures continue, FAO food price index rises
... Your browser is blocking javascript. This might limit your experience on this website. SUBSCRIBE. FREE NEWSLETTER. Breaking News on Food & Beverage Development - Europe US edition. Asian edition. News Science Market Trends Business Policy VIEWS. Site Archive October 2015 September 2015 Previous months. Sectors Bakery Beverage Confectionery Dairy Healthy foods Prepared foods Snacks. Trends Marketing Organics GM food Sugar and health Sustainable sourcing Food prices Natural and clean label Sugar, salt and fat reduction. Multimedia Videos Audios Galleries Online Events. Ingredients Carbohydrates and fibres sugar, starches Cereals and bakery preparations Chocolate and confectionery ingredients Cultures, enzymes, yeast Dairy-based ingredients Emulsifiers, stabilisers, hydrocolloids. Fats & oils Flavours and colours Food labelling Food safety Fruit, vegetable, nut ingredients Health and nutritional ingredients. Meat, fish and savoury ingredients Preservatives and acidulants Proteins, non-dairy Sweeteners inten...
http://foodnavigator.com/Market-Trends/Manufacturer-price-pressures-continue-as-FAO-food-price-index-rises
*  Stanford forum on how food policies affect our nation’s obesity rates posted online | Scope Blog
Stanford forum on how food policies affect our nation’s obesity rates posted online. Scope Blog. Published by Stanford Medicine. Health Policy, Nutrition, Obesity, Public Health, Stanford News, Videos. Stanford forum on how food policies affect our nation’s obesity rates posted online Lia Steakley on December 13th, 2012. 3 Comments. Two weeks ago, the Stanford Health Policy Forum hosted an event examining the reasons why we get fat and how different diet trends and food policies affect our nation’s obesity rates. The forum featured a conversation between science writer Gary Taubes and Christopher Gardner, PhD, director of Nutrition Studies at the Stanford Prevention Research Center. During the discussion, Paul Costello, the medical school’s chief communications officer, talked to Taubes and Gardner about Americans misconceptions about food, diet and nutrition, the driving forces behind the obesity surge of the late-80s and the path to a healthier, leaner lifestyle. Previously: Forum to focus on how food polic...
http://scopeblog.stanford.edu/2012/12/13/stanford-forum-on-how-food-policies-affect-our-nations-obesity-rates-posted-online/
*  Find the fridge: spoiled foods cost business a fortune | The Northern Daily Leader
Find the fridge: spoiled foods cost business a fortune. The Northern Daily Leader. . Weather. Your 4-day local weather forecast. Tuesday October 6, 2015. Life Style. Larger / Smaller. Night Mode. Find the fridge: spoiled foods cost business a fortune By Adrian Lowe Jan. 23, 2013, 11:13 a.m. Tweet. Print Story. Unless you would like a date with the porcelain, put your lunch in the fridge. Find the fridge: spoiled foods cost business a fortune. Uncool ... Could your lunch be a health hazard. Tweet Facebook. of. ╳. exit. Unless you would like a date with the porcelain, put your lunch in the fridge. That's the advice from the Food Safety Information Council, which warns that many Australians fail to follow simple instructions to avoid food poisoning. But employers appear to need to help out - a recent council survey found that many of the office workers who don't use the fridge for their lunch believe that it's more an incubator for food disasters than a way to keep food clean and cool. The annual survey o...
http://northerndailyleader.com.au/story/1253210/find-the-fridge-spoiled-foods-cost-business-a-fortune/?cs=24
*  Tate & Lyle - Speciality Food Ingredients
Tate Lyle - Speciality Food Ingredients. SUBSCRIBE. FREE NEWSLETTER. Breaking News on Supplements & Nutrition - Europe US edition. Sectors Supplements Botanicals Functional foods Whole foods. Dairy Baked goods, snacks & sweets Beverages Sports Nutrition. Energy Eye health Gut/digestive health Healthy ageing Immune support Inflammation Maternal & infant health. Men's Health Oral/Gum health Respiratory health Skin health Sports nutrition Weight management Women's health. Jobs Food Jobs - Europe. Food Jobs - USA. Food Jobs - UK. Tate & Lyle - Speciality Food Ingredients. Tate Lyle - Sweeteners, Texturants, Health and Wellness Ingredients Tate Lyle is a global provider of ingredients and innovative solutions to the food, beverage and other industries. Maternal infant health. Respiratory health. Skin health. Weight management. Women's health. Sports nutrition. Oral/Gum health. FoodNavigator.com Food & Beverage Development - Europe FoodNavigator-USA.com Food & Beverage Development - North America FoodNavigator-Asia...
http://nutraingredients.com/Ingredients/Fibers-carbohydrates/Tate-Lyle-Food-Ingredients
*  Sending food to the US
... Industry foodsafety.govt.nz Consumer foodsmart.govt.nz MPI mpi.govt.nz Biosecurity biosecurity.govt.nz. MPI Food Safety Food safety. Foodborne illnesses. High risk foods. Hunting, collecting, fishing homekill. What's in our food. Allergies intolerances. Overview. Specific food allergens. Identifying allergens in food. Food intolerances. Overview. Animal diseases. Overview. Specific animal diseases. Bringing food into/out of NZ. Overview. Bringing in food to sell. Bringing in food for yourself. Taking food to the EU. Sending food to the US. Taking food to and from the Pacific islands. Taking NZ honey overseas. Consumer eLibrary. Advanced search. Pregnant women People with low immunity People with babies toddlers People with children Older people M ori, Pacific other cultures Teachers Ordering resources. Bringing food into/out of NZ: Overview. Bringing in food to sell. Bringing in food for yourself. Taking food to and from the Pacific islands. Sending food to the US. Taking food to the EU. Taking NZ honey ...
http://foodsmart.govt.nz/bringing-food-in-out-of-nz/USA/
*  Vegsoc Approved
Any Food - Baby Food Food - Bakery Sundries Food - Beers, Lagers and Ciders Food - Biscuits Food - Bread Products Food - Burgers Food - Butters and Spreads Food - Cakes Food - Cereals Food - Cheese Food - Cheese Alternatives Food - Cold Drinks Food - Confectionery - General Food - Confectionery - Special food - confectionery - Special Food - Confectionery - Special Food - Convenience Foods Food - Crisps and Snack Biscuits Food - Dairy Ingredients Food - Dairy Products Food - Desserts Food - Drinks - Sundry Food - Eggs Food - Fats & Oils Food - Flavours & Flavour Enhancers Food - Fromage Frais & Yoghurts Food - Fruit Food - Gums, Starches & Stabilisers Food - Hot Drinks Food - Imported Food & Drink Food - Ingredients - Bakery Food - Ingredients - Sundry Food - Meat Alternatives Food - Milk & Cream Food - Other Snacks Food - Pasta and Rice Food - Pastries Food - Preserves & Spreads Food - Pulses Food - Sauces Food - Sausages - Vegetarian Food - Snack-not Crisps etc Food - Soup Food - Soya Milk Food - Speciality...
http://vegsocapproved.com/corporate08/company.asp?id=938&offset=0&order=cat&dir=ASC
*  Cutting back on 4 white foods can help with weight loss | WGAL Home - WGAL Home
Cutting back on 4 white foods can help with weight loss. WGAL Home - WGAL Home. Back To Mobile Site Back To Mobile Site. Manage Subscriptions Log Out. Log In. Alerts Mobile Submit a Tip. Advertisement. News. boston marathon. Weather. Live Radar. Health. Green Pages. u local. On TV. Community. Brain Busters. Community. Marketplace. Food. Get Coupons. Ad Profit Seminar. Premier Bridal Event 2013. Legal Center. Gas Up And Go. Local Pros. Gas Up And Go. Contests. NOWCAST. Watch WGAL News 8 Live. Cutting back on 4 white foods can help with weight loss Published 1:58 PM EST Dec 04, 2013. NEXT STORY Arrest made in morning homicide in Manheim Township. Text Size:. A Small Text. A Medium Text. A Large Text. iStock Photos. iStock. By Mayo Clinic News Network Related. How to avoid the freshman 15. Foods that fight breast cancer. How to dress for fall workouts. Staying active during, after cancer... Memory loss: 7 tips to improve your... Taking white bread and white potatoes, as well as white rice and white pasta, out of...
http://wgal.com/cutting-back-on-4-white-foods-can-help-with-weight-loss/23288634
*  Energy Has More Impact On Food Prices Than Ethanol » Market to Market » Iowa Public Television
Energy Has More Impact On Food Prices Than Ethanol Market to Market Iowa Public Television. Iowa Public Television Skip to main content. Energy Has More Impact On Food Prices Than Ethanol posted on April 17, 2009. According to the report, ethanol was responsible for a mere eight-tenths of one percent of last year's 5.1 percent increase in retail food prices. Closer examination of the data revealed energy costs, which were on their way to record highs, were more to blame for higher food prices between April 2007 and April 2008. Tom Buis, CEO, Growth Energy: "The rapid increase in food prices was not a result of ethanol or farm commodity prices." Tom Buis, CEO, Growth Energy: "I think the facts speak for themselves. You know, food prices, and many of the big companies, had record quarterly profits during that period." Other groups joining to proclaim that farmers were ready to produce the corn necessary to satisfy America's food, feed, and fuel needs were the National Farmers Union, the National Corn Growers As...
http://iptv.org/mtom/story.cfm/lead/4431/mtom_20090417_3433_lead2
*  Food Premises and Food Complaints • Test Valley Borough Council
Food Premises and Food Complaints Test Valley Borough Council. Members' area. relaxed dark. Test Valley Borough Council. About the council. Food Safety Food Premises and Food Complaints. Starting up a New Food Business Export Certificates Food Alerts Food Hygiene Training Food Premises Approval Food Premises Registration Food Safety Inspections Food Sampling Food Premises and Food Complaints National Food Hygiene Rating Scheme. Food Premises and Food Complaints. If you have a problem with an item of food you have purchased in the Test Valley Borough, you can tell us and we will look into it. If possible, place the food item in an unused polythene food bag and keep it somewhere safe such as a fridge or freezer. A copy of the Food and Food Premises Complaints Policy can be downloaded below. a Information we will need from you: your full name; your full address including your postcode; your home telephone number and a number which we can contact you on during normal office hours if this is different; your email ...
http://testvalley.gov.uk/business/licensingandregulation/foodsafety/making-food-complaint/?displaypref=3
*  .. All About Nutrition .. Seven Best and Seven Worst Foods for Health and Lon
All About Nutrition. Pin It. Seven Best and Seven Worst Foods for Health and Longevity. Dr. Joel Fuhrman on eating for your health in the long term. Because food has the power to heal, my patients often ask me for my top list of healthy food – the anti-oxidant foods, heart healthy foods, and nutritious foods that are central to the Eat To Live program. These high nutrient foods, consumed regularly, will contribute to your health and longevity. What you eat — now and when you were growing up — dramatically affects the state of your health. The effect is cumulative, influencing everything from the amount of energy you have or lack, to your emotional state, medical condition, and ultimately longevity. Top Seven Foods for Good Health and Longevity. Black raspberries Strawberries Blueberries Flax Seeds Green Leafy Vegetables Tomatoes Broccoli sprouts. The healthy and nutritious foods are high antioxidant foods, primarily fruits and vegetables. I selected these healthy foods because they contain the most powerful p...
http://goldsgym.com/article/seven-best-and-seven-worst-foods-for-health-and-longevity/
*  Food Poisoning
... What Is Food Poisoning. Do I Have Food Poisoning. What Will the Doctor Do. How to Fight the Germs. No one put poison in your food, but bacteria probably grew in the food in the fridge and those bacteria made you sick. What Is Food Poisoning. Food poisoning comes from eating foods that contain germs like bad bacteria or toxins, which are poisonous substances. Bacteria are all around us, so mild cases of food poisoning are common. You may have had mild food poisoning with diarrhea and an upset stomach but your mom or dad just called it a stomach bug or stomach virus. Bacteria are all around us, including in food, and sometimes they can be good for us. It's confusing, but one thing is for sure the bacteria in the rotten leftovers weren't the good-for-you kind. Foods from animals, raw foods, and unwashed vegetables all can contain germs that cause food poisoning. coli say: EE KOLE-eye To avoid food poisoning, people need to prepare, cook, and store foods properly. have an upset stomach called nausea , say: N...
http://kidshealth.org/PageManager.jsp?dn=CookChildrensHospital&lic=403&cat_id=20080&article_set=22037&ps=304
*  Cutting back on 4 white foods can help with weight loss | Healthy Living - WISN Home
Cutting back on 4 white foods can help with weight loss. Healthy Living - WISN Home. Back To Mobile Site Back To Mobile Site. Manage Subscriptions Log Out. Log In. Alerts Mobile Submit a Tip. Follow. Advertisement. News. Pope Benedict XVI Resignation Papal Election. Wisconsin News. boston marathon. Weather. Allergy Report. u local. On TV. Community. Politics. Election Results. Community. WaterWatch. Marketplace. Get Coupons. Sunday Gardener. Sunday Gardener. A-List. Legal Center. Contests. Trips on a Tank. A-List. Home. / Healthy Living. Cutting back on 4 white foods can help with weight loss Published 8:40 AM CST Dec 09, 2013. Tweet. NEXT STORY Horny Goat Pub to close at end of the week. Text Size:. A Small Text. A Medium Text. A Large Text. iStock Photos. iStock. By Mayo Clinic News Network Related. How to avoid the freshman 15. Foods that fight breast cancer. How to dress for fall workouts. Staying active during, after cancer... Memory loss: 7 tips to improve your... Taking white bread and white potatoes, ...
http://wisn.com/healthy-living/cutting-back-on-4-white-foods-can-help-with-weight-loss/23391802
*  Calories in Wegmans - Food You Feel Good About Rainbow Blend | Nutrition and Health Facts
Calories in Wegmans - Food You Feel Good About Rainbow Blend. Calories in Food You Feel Good About Rainbow Blend. Wondering how many calories are in Food You Feel Good About Rainbow Blend. Manufactured by Wegmans. Add to Log Food You Feel Good About Rainbow Blend. Food You Feel Good About Rainbow Blend A Grade 35 Calories. Food You Feel Good About Rainbow Blend Calories and Health Benefits. GOOD POINTS No saturated fat No cholesterol High in calcium Very high in dietary fiber Very high in vitamin A High in vitamin C. Get Nutritional Facts and the Health Benefits for Food You Feel Good About Rainbow Blend. Wegmans Food You Feel Good About Rainbow Salad - Cleaned and Cut Wegmans Food You Feel Good About Sherbet - Rainbow Wegmans Food You Feel Good About Italian Blend - Organic Wegmans Food You Feel Good About Salad - French Blend Wegmans Food You Feel Good About Salad - Fresh American Blend Wegmans Food You Feel Good About Blueberry Nut Blend Wegmans Food You Feel Good About Special Blends - Grilled Vegetables ...
http://caloriecount.com/calories-wegmans-food-you-feel-good-i270765
*  Fine Foods & Pharmaceuticals N.T.M. S.p.A.
Fine Foods amp; Pharmaceuticals N.T.M. SUBSCRIBE. Sectors Supplements Botanicals Functional foods Whole foods. Dairy Baked goods, snacks & sweets Beverages Sports Nutrition. Men's Health Oral/Gum health Respiratory health Skin health Sports nutrition Weight management Women's health. Ingredients Antioxidants/carotenoids Botanicals & Herbals Dairy-based ingredients Dosage forms & delivery formats Fibers & carbohydrates. Minerals Nutricosmetics Omega-3s & Nutritional oils Polyphenols Probiotics and prebiotics. Jobs Food Jobs - Europe. Food Jobs - USA. Food Jobs - UK. Fine Foods Pharmaceuticals N.T.M. Last but not least Fine Foods Pharmaceuticals N.T.M. Main technology at Fine Foods Pharmaceuticals N.T.M. Today Fine Foods Pharmaceuticals N.T.M. Dairy-based ingredients. Omega-3s Nutritional oils. Soy-based ingredients. FoodNavigator.com Food & Beverage Development - Europe FoodNavigator-USA.com Food & Beverage Development - North America FoodNavigator-Asia.com Food, Beverage & Supplement Development - Asia Pacifi...
http://nutraingredients.com/Health/Cognitive-function/Fine-Foods-amp-Pharmaceuticals-N.T.M.-S.p.A
*  What Do Specific Foods Do?
What Do Specific Foods Do. Published on Taking Charge of Your Health Wellbeing http://www.takingcharge.csh.umn.edu Home. Explore Healing Practices. Food As Medicine What Do Specific Foods Do. What Do Specific Foods Do. What Do Specific Foods Do. Related Pages How Does Diet Impact Health. The Mediterranean Diet. Interview with Mimi Guarneri. Heart Disease. Diabetes. Cancer. No. Let thy food be thy medicine and thy medicine be thy food. - Hippocrates 460-377 BC You need only to view the movie Super Size Me to understand how foods impact the body. In the movie, the director Morgan Spurlock chronicles the adverse health outcomes he experienced from eating nothing but fast food for several weeks. He not only gained weight, he experienced alarming metabolic changes that put him at risk for heart disease., diabetes., and hypertension. Spurlock was eating foods that gave his body the wrong messages. For instance, in just a few weeks, the excessive amounts of saturated and trans-fatty acids in the fast food diet led t...
http://takingcharge.csh.umn.edu/print/423?quicktabs_2=1
*  Pickles & Pickling - Food Facts - Food Reference
... FoodReference.com since 1999 Food Articles, News Features Section. Share. Home. Food Articles. Food Trivia. Today In Food History. Food Timeline. Videos. Recipes Cooking Tips. Food Quotes. Who's Who. Food Trivia Quizzes. Crosswords. Food Poems Free Magazines. Recipe Contests. Culinary Schools. Gourmet Tours. Food Festivals. You are here. Home. Food Articles. Cooking Methods, Specific Pickles Pickling Next. CULINARY SCHOOLS and COOKING CLASSES From Amateur Basic Cooking Classes to Professional Chef Training Degrees - More than 1,000 schools classes listed for all 50 States, Online and Worldwide. PICKLES PICKLING See Also: Pickle Trivia - Pickle Lovers - Pickle Quotes. Pickled or Pickling. Any food can be pickled, but a PICKLE used as a NOUN refers to a pickled CUCUMBER. There are pickled vegetables of all types, as well as various pickled fish, etc. Pickling is one of the oldest methods of preserving foods. Pickling is the preserving of food in an acid usually vinegar, and it is this acid environment ...
http://foodreference.com/html/artpickles.html
*  my baby is 8 months old..what kind of solid foods can i give him? help | BabyCenter
my baby is 8 months old..what kind of solid foods can i give him? help. BabyCenter. COMMUNITY. BLOG. PRODUCTS & GEAR. MISSION MOTHERHOOD. Community Home. COMMUNITY. Mom Answers. Shop. Answer a question Ask a question. advertisement. Getting Pregnant Pregnancy Baby Baby Schedules Baby Bathing & Body Care Breastfeeding Childcare Crying & Colic Baby Diapering & Bottom Care Formula Feeding Your Newborn Baby Premature Babies Baby Sleep Solids & Finger Foods Your Postpartum Health Activities & Play Behavior Baby Development Special Situations Diapering Products On the Go Products Activities & Play Products Baby Care Products Nursery Products Feeding Products For Mom Health & Safety Products Toddler Preschooler Big Kid Children's Health You & Your Family. Question. my baby is 8 months old..what kind of solid foods can i give him? help. Report question. Mom Answers. Sort by: best answers. most recent answers. 1 - 1 of 1 answers. but always make sure you feed him just a bit not too much for his little tummy....
http://babycenter.com/400_my-baby-is-8-months-old-what-kind-of-solid-foods-can-i-give_9251950_377.bc
*  .. How City Food can Bridge the Urban-Rural Divide .. Trackbacks
You are here: Home / local food / How City Food can Bridge the Urban-Rural Divide How City Food can Bridge the Urban-Rural Divide. November 22, 2011 By. Dilya Niezova. 1 Comment. Tweet. It’s a given that better food habits can help cure what ails individual bodies that are overweight or undernourished, but what if better food habits on the part of city governments can just as effectively help cure what ails the body politic. Our current urban-rural divide needs to be addressed if we want to truly move towards sustainable food growing practices. . It’s a tall order, but I’m inspired to try it because of this month’s election results in my neck of the woods, Ontario. Though north of the U.S. border, Ontario is not far geographically or culturally from many northern and U.S. states; indeed, my home town of Toronto is closer to more cities and people in the US than any city in the US. Just as you can count on Canucks to occupy Bay Street shortly after Yanks occupy Wall Street, you can also count on the fa...
http://wayneroberts.ca/archives/768/comment-page-1
*  Food Poisoning
... What Is Food Poisoning. What Causes Food Poisoning. Common Food Poisoning Germs. Most of the time, doctors use "food poisoning" to describe an illness that comes on quickly after eating contaminated food. When people need medical treatment for food poisoning, it's often because of dehydration. When people eat or drink something that's contaminated with germs, they can get sick with food poisoning. Often, people get food poisoning from animal-based foods like meat, poultry, eggs, dairy products, and seafood. But unwashed fruits, vegetables, and other raw foods also can get contaminated and make people sick. Foods can become infected with bacteria if they're stored at the wrong temperature or kept too long. These bacteria usually get into foods when they come into contact with animal feces. E coli bacteria, too, typically get into food or water when they come into contact with animal feces. Listeria bacteria also can contaminate fruits and vegetables, although that's less common. As with other kinds of bac...
http://kidshealth.org/PageManager.jsp?dn=American_Academy_of_Family_Physicians&lic=44&cat_id=20174&article_set=84626&tracking=T_RelatedArticle
*  Iams® Naturals Adult Dog Food | Dry Food | PetSmart
Iams® Naturals Adult Dog Food. Dry Food. PetSmart. PetPerks. Store Locator. Welcome to PetSmart. Dog. View all. Food Health. Food. Vitamins Wellness. Supplies Training. Grooming Supplies. Pet Memorials. Stain Odor Removers. Featured Shops. Featured Shops. Food Center. Sale. Dog. View all. Food Health. Food. Vitamins Wellness. Supplies Training. Grooming Supplies. Pet Memorials. Stain Odor Removers. Featured Shops. Featured Shops. Food Center. Sale. Fish. Fish. View all. Food Care. Food. Free Shipping on Orders of $49+ or Free Store Pickup where available Learn more. Serve your pooch the fresh flavors of the farm with this Iams Grain-Free Naturals Chicken & Garden Pea Dog Food, which is made with high-quality protein from farm-raised chicken and farm-grown fruits and vegetables for a tasty meal. Features: Made with high-quality protein and farm-grown fruits and veggies to provide a wholesome meal; contains no grains, chicken by-product meal, corn, wheat, soy or artificial preservatives, colors or flavors; vita...
http://petsmart.com/food-health/dry-food/iams-naturals-adult-dog-food-zid36-20937/cat-36-catid-100032?var_id=36-20937
*  The Effects of Relative Food Prices on Obesity -- Evidence from China: 1991-2006
... NATIONAL BUREAU OF ECONOMIC RESEARCH. The Effects of Relative Food Prices on Obesity -- Evidence from China: 1991-2006. NBER Working Paper No. This paper explores the effects of relative food prices on body weight and body fat over time in China. While we find that decreases in the price of energy-dense foods have consistently led to elevated body fat, this price effect does not always hold for body weight. In addition, food prices and subsidies could be used to encourage healthier food consumption patterns and to curb obesity. The NBER Bulletin on Aging and Health provides summaries of publications like this. You can sign up to receive the NBER Bulletin on Aging and Health by email. w15096 Food Prices and the Dynamics of Body Weight. w19143 Food Prices and Body Fatness among Youths. National Bureau of Economic Research, 1050 Massachusetts Ave., Cambridge, MA 02138; 617-868-3900 ; email: info@nber.org. Working Papers & Publications. Working Papers. AUTHOR OR TITLE SEARCH OF WORKING PAPERS. This Week's Wo...
http://nber.org/papers/w15720
*  .. Four simple steps to prevent food poisoning
7 · 11. 2013. Four simple steps to prevent food poisoning. Summer means picnics, buffets, barbecues and outdoor parties – and an increased risk of food poisoning. Getting sick from improperly prepared or stored food is more common and more serious than you might realize. In the United States, food poisoning sends more than 100,000 people to the hospital each year, and it can have long-term health consequences. Common symptoms include abdominal cramps, nausea, fever, joint/back aches and fatigue. It is important to make sure that food served at picnics, buffets, barbeques and parties is safe. Four simple steps can help to protect you and your family and friends from food poisoning:. Clean it:. Wash hands with soap and water before preparing or eating food. Wash kitchen surfaces, cutting boards and utensils with soap and hot water. Wash all raw fruits and vegetables. Separate it:. Don’t allow juices from meat, seafood, poultry or eggs to drip on other foods. Use a separate cutting board and knife for raw me...
http://childrensmn.org/Blog/KidsHealth/2013/07/four-simple-steps-to-prevent-food-poisoning/
*  Food Premises and Food Complaints • Test Valley Borough Council
Food Premises and Food Complaints Test Valley Borough Council. Skip. Members' area. Accessibility default. relaxed light. dark. relaxed dark. Test Valley Borough Council. Residents. Businesses. About the council. Search. GO. A to Z of Council Services: A. B. C. D. E. F. G. H. I. J. K. L. M. N. O. P. Q. R. S. T. U. V. W. X. Y. Z. #. Business. Licensing Regulation. Food Safety Food Premises and Food Complaints. Starting up a New Food Business Export Certificates Food Alerts Food Hygiene Training Food Premises Approval Food Premises Registration Food Safety Inspections Food Sampling Food Premises and Food Complaints National Food Hygiene Rating Scheme. Food Premises and Food Complaints. If you have a problem with an item of food you have purchased in the Test Valley Borough, you can tell us and we will look into it. If possible, place the food item in an unused polythene food bag and keep it somewhere safe such as a fridge or freezer. We can then arrange for one of the team to collect the item from you for inves...
http://testvalley.gov.uk/business/licensingandregulation/foodsafety/making-food-complaint/?displaypref=2
*  Nonfood Compounds - Publications - NSF International
... Aerospace Automotive Building Products and Interiors Chemical Consumer Products Dietary Supplements Food Safety and Quality Medical Devices Pharma Biotech Plastics Sustainability and Environment Water and Wastewater. Product Certification Management Systems Lab and Testing Services Standards and Publications Auditing and Inspection Consulting. Training for Regulators Advocacy World Health Organization WHO Working With NSF NSF Certification NSF Standards Academia Key Related Organizations Regulatory and Public Health Expertise Certification Enforcement Actions Related Content. Consumer Resources What Is NSF Certification. About the Scrub Club® Training Education Dietary Supplements Training Food Safety and Quality Training Management Systems Registration Training Medical Devices Training Pharma Biotech Training Water and Wastewater Training All Other Sectors About NSF. Newsroom. News Releases NSF in the News Events Product/Services News NSF Experts Consumer News Newsletters Related Content. Newsroom. News...
http://nsf.org/index.php/newsroom/publications/category/nonfood-compounds?date=07-2012
*  Nonfood Compounds - Publications - NSF International
... Aerospace Automotive Building Products and Interiors Chemical Consumer Products Dietary Supplements Food Safety and Quality Medical Devices Pharma Biotech Plastics Sustainability and Environment Water and Wastewater. Product Certification Management Systems Lab and Testing Services Standards and Publications Auditing and Inspection Consulting. Training for Regulators Advocacy World Health Organization WHO Working With NSF NSF Certification NSF Standards Academia Key Related Organizations Regulatory and Public Health Expertise Certification Enforcement Actions Related Content. Consumer Resources What Is NSF Certification. About the Scrub Club® Training Education Dietary Supplements Training Food Safety and Quality Training Management Systems Registration Training Medical Devices Training Pharma Biotech Training Water and Wastewater Training All Other Sectors About NSF. Newsroom. News Releases NSF in the News Events Product/Services News NSF Experts Consumer News Newsletters Related Content. Newsroom. News...
http://nsf.org/index.php/newsroom/publications/category/nonfood-compounds?date=09-2013
*  Nonfood Compounds - Publications - NSF International
... Aerospace Automotive Building Products and Interiors Chemical Consumer Products Dietary Supplements Food Safety and Quality Medical Devices Pharma Biotech Plastics Sustainability and Environment Water and Wastewater. Product Certification Management Systems Lab and Testing Services Standards and Publications Auditing and Inspection Consulting. Training for Regulators Advocacy World Health Organization WHO Working With NSF NSF Certification NSF Standards Academia Key Related Organizations Regulatory and Public Health Expertise Certification Enforcement Actions Related Content. Consumer Resources What Is NSF Certification. About the Scrub Club® Training Education Dietary Supplements Training Food Safety and Quality Training Management Systems Registration Training Medical Devices Training Pharma Biotech Training Water and Wastewater Training All Other Sectors About NSF. Newsroom. News Releases NSF in the News Events Product/Services News NSF Experts Consumer News Newsletters Related Content. Newsroom. News...
http://nsf.org/index.php/newsroom/publications/category/nonfood-compounds?date=12-2012
*  Food Poisoning
... Common Food Poisoning Germs. After eating germ-infected food, a person can develop sudden and severe symptoms like vomiting and diarrhea. When people need medical treatment for food poisoning, it's often because of dehydration, which is the most common serious complication of food poisoning. Often, people get food poisoning from animal-based foods like meat, poultry, eggs, dairy products, and seafood. But unwashed fruits, vegetables, and other raw foods also can get contaminated and make someone sick. Water that is used to grow food can become infected with animal or human feces poop. Foods can become infected with bacteria if they're stored at the wrong temperature or kept too long. These bacteria usually get into foods when they come into contact with animal feces. E coli bacteria, too, usually get into food or water when they come into contact with animal feces. These bacteria are mostly found in unpasteurized dairy products, smoked seafood, and processed meats like hot dogs and luncheon meats. Lister...
http://kidshealth.org/PageManager.jsp?dn=CookChildrens&lic=403&cat_id=20028&article_set=84622&tracking=P_RelatedArticle
*  Why are processed foods cheaper than fresh foods? - Eating & Society - Sharecare
Why are processed foods cheaper than fresh foods. - Eating & Society - Sharecare. Topics. Question Eating and Society Why are processed foods cheaper than fresh foods. Topics. Diet Nutrition. Eating and Society. Why are processed foods cheaper than fresh foods. Processed foods do tend to be less expensive than most fresh foods. In addition, lean meats and fish, as well as fresh fruits and vegetables, are highly perishable items, and there's a cost involved in delivering them unsullied to your table or cafeteria tray. Fresh, wholesome foods are not intrinsically more expensive to produce. Therefore, our government subsidizes crops that provide these food-like products corn, soybeans, and wheat so that they become very cheap to purchase and the most profitable for farmers to grow. Find out more about this book: The Dorm Room Diet: The 10-Step Program for Creating a Healthy Lifestyle Plan That Really Works Buy book. It should not be used for medical advice, diagnosis or treatment. Give These Junk Food Faves a He...
https://sharecare.com/health/eating-and-society/why-processed-foods-cheaper-fresh
*  Eukanuba® Excel Premium Adult Dog Food | Dry Food | PetSmart
Eukanuba® Excel Premium Adult Dog Food. PetSmart. PetPerks. Store Locator. Welcome to PetSmart. Dog. View all. Food Health. Food. Grooming Supplies. Featured Shops. Featured Shops. Food Center. Sale. Dog. View all. Food Health. Food. Grooming Supplies. Featured Shops. Featured Shops. Food Center. Sale. View all. Food Care. Food. Free Shipping on Orders of $49+ or Free Store Pickup where available Learn more. An Estimated Delivery Date is a calculation of several factors, including item availability, processing time in our warehouse, the shipping method you select and the shipping destination. Packed with the delicious flavor of salmon, this Eukanuba Excel Adult Salmon Premium Dog Food is sure to cater to your canine's cravings, while providing an optimal source of the animal proteins that help support lean muscles. Features: Animal proteins from salmon help support lean muscles; formulated to promote skin and coat health, strong and healthy teeth and a strong immune system; made without corn or chicken by-pro...
http://petsmart.com/gsi/webstore/WFS/PETNA-PETUS-Site/en_US/-/USD/ViewProduct-Start;pgid=wapeef9OpNlSRpTcGB5iOtCt0000eSU8gVyX?SKU=36-18672
*  Fine Foods & Pharmaceuticals N.T.M. S.p.A.-SIC-Food-2013
Fine Foods Pharmaceuticals N.T.M. SUBSCRIBE. Sectors Supplements Botanicals Functional foods Whole foods. Dairy Baked goods, snacks & sweets Beverages Sports Nutrition. Trends Health claims Omega-3 Probiotics Financial plays Botanicals Phood. Men's Health Oral/Gum health Respiratory health Skin health Sports nutrition Weight management Women's health. Ingredients Antioxidants/carotenoids Botanicals & Herbals Dairy-based ingredients Dosage forms & delivery formats Fibers & carbohydrates. Minerals Nutricosmetics Omega-3s & Nutritional oils Polyphenols Probiotics and prebiotics. Jobs Food Jobs - Europe. Food Jobs - USA. Fine Foods Pharmaceuticals N.T.M. Last but not least Fine Foods Pharmaceuticals N.T.M. Main technology at Fine Foods Pharmaceuticals N.T.M. Today Fine Foods Pharmaceuticals N.T.M. Dairy-based ingredients. Omega-3s Nutritional oils. FoodNavigator.com Food & Beverage Development - Europe FoodNavigator-USA.com Food & Beverage Development - North America FoodNavigator-Asia.com Food, Beverage & Supple...
http://nutraingredients.com/Health/Bone-joint-health/Fine-Foods-amp-Pharmaceuticals-N.T.M.-S.p.A
*  .. Food Justice discussion generates local campaign idea .. Like this: .. Related
Food Justice discussion generates local campaign idea. tags: Bloom Collective, Food Justice, local food system, Our Kitchen Table. Yesterday, a group a people gathered at Garfield Park, near the South East Farmers Market, to discussion the idea of Food Justice. People talked about some local efforts with food justice, the work of Our Kitchen Table, the treatment of migrant workers, CSA’s, food co-ops and ways to target or dismantle the local agribusiness system. One local idea that was discussed would be a campaign to investigate the existing food contract that the Grand Rapids Public Schools GRPS have and then develop a campaign to have the food served in the schools be local and organic. This food system is extremely unsustainable, relies on massive government subsidies, fossil fuels, pesticides and migrant labor. Agribusiness usually engages in mono-cropping and often relies on migrant labor, which is highly exploitative. Food Distributors – Food distributors sometimes are just involved in transporting...
http://griid.org/2012/07/15/food-justice-discussion-generates-local-campaign-idea/
*  .. Makanan Sehat .. Healthy Foods – Exactly about Nutrients To Makanan Sehat Eat! .. Post navigat
April 23, 2013 by curapik1. Makanan Sehat Healthy Foods – Exactly about Nutrients To Makanan Sehat Eat. Are you aware that our society is within the midst of the health Makanan Sehat craze. However you turn there may be details about being healthier. Maintaining a healthy diet foods is obviously one of the best approaches to improve your health. In case people hear those two words they visualize boring, bland foods which might be widely accessible as a natural food co-op. Although healthy food are things that you have eaten virtually every day, sometimes just prepared in different ways. Healthy foods as well as diet regime is pleasing both to Cara Menurunkan Berat Badan the palate and plate. However one must bear in mind sensible food is that the closer food is to its natural Makanan Sehat state the healthier it’s to suit your needs. Firstly you will start varying your eating routine to more healthy foods by Makanan Sehat cutting down on the amount of prepared foods you eat. Prepackaged foods contain preserva...
https://caramemperbesarotot.wordpress.com/2013/04/23/makanan-sehat/
*  Health Benefits of Raw & Fermented Foods | Food Renegade
Health Benefits of Raw Fermented Foods. Food Renegade. . Get a FREE copy of my report The 7 Most Shocking Things the Health Food Industry Will Never Tell You + my newsletter AND special health deals. YES. SEND IT TO ME. Food Renegade challenging politically correct nutrition. HOME. RECIPES. SHOPPING GUIDE. BASICS. Real Milk. Real Meat. Real Eggs. Fermented Raw. Real Food. REBEL. Eating Real Food On A Budget. Newbie Tips. Healthy Foods: What To Buy. BOOKS CLASSES. ABOUT. Disclosure. Comments. Privacy Policy. CONTACT Health Benefits of Raw Fermented Foods by. Kristen Michaelis. 15 Comments. Affiliate Disclosure. She sat across the table from me enviously eyeing my salad. I d really love some vegetables right now, she said. We started talking about her diet the typical diet of the typical American. I told her that 60-80% of the diet of traditional people groups isn t cooked. Oh, she interrupted, I bet I don t cook 60% of the food I eat. She missed my point. She was talking about sandwiches and cold breakfast cer...
http://foodrenegade.com/health-benefits-of-raw-fermented-foods/
*  Food Poisoning
... About Vidant. No one put poison in your food, but bacteria probably grew in the food in the fridge and those bacteria made you sick. Food poisoning comes from eating foods that contain germs like bad bacteria or toxins, which are poisonous substances. You may have had mild food poisoning with diarrhea and an upset stomach but your mom or dad just called it a stomach bug or stomach virus. Bacteria are all around us, including in food, and sometimes they can be good for us. Foods from animals, raw foods, and unwashed vegetables all can contain germs that cause food poisoning. coli say: EE KOLE-eye To avoid food poisoning, people need to prepare, cook, and store foods properly. have an upset stomach called nausea, say: NAW-zee-uh have stomach cramps have diarrhea say: dye-uh-REE-uh, which may contain blood have a fever Sometimes feeling sick from food poisoning shows up within hours of eating the bad food. With mild cases of food poisoning, you will not feel sick for very long and will soon be feeling fine ...
http://kidshealth.org/PageManager.jsp?dn=Vidant_Medical_Center&lic=203&cat_id=20080&article_set=22037&ps=304
*  .. Examples Of Genetically Modified Food Products & Crops .. Stay Updated: .. Latest From GMO: .. Y
Home » GMO » Examples Of Genetically Modified Food Products Crops. Examples Of Genetically Modified Food Products Crops. Processed foods are normally measured examples of genetically modified food because they contain genetically modified ingredients. It is hard to compile a list of foods that contain genetically modified ingredients all the same when purchasing products if you see the following ingredients are included then the processed food will be measured a genetically modified food. Examples of such genetically modified food or rather ingredients utilized in processed food include Corn, which has been developed to resist pests therefore it is consequential to look out for genetically modified corn in oils, drinks, snacks etc, likewise Canola commonly used to create margarine additionally oils, or even cotton seed oil similarly used in snacks, fried furthermore baked goods. Other examples of genetically modified food includes dairy products statistics have proven that 22% of US cows are injected with bov...
http://imarketingbiz.net/examples-of-genetically-modified-food-products-crops/
*  How Food Affects Your Moods
... Health A-Z. Depression. Diabetes. Featured Topics. Second Opinion: Read expert perspectives on popular health topics. Communities: Connect with people like you, and get expert guidance on living a healthy life. WebMD Pain Coach. Find Information About:. WebMD My Medicine Save your medicine, check interactions, sign up for FDA alerts, create family profiles and more. Sign up to receive WebMD's award-winning content delivered to your inbox. FDA Approves Diet Pill Belviq. WebMD Mobile Drug Information App. Living Healthy. Featured Content. Diet, Food Fitness. Diet Weight Management. Fitness Exercise. Healthy Beauty. Women's Health. Featured Topics. Fight allergies with daily forecasts, local alerts, and personalized tips. Family Pregnancy. Featured Content. Sign up to receive WebMD's award-winning content delivered to your inbox. Connect with people like you, and get expert guidance on living a healthy life. 10 Ways to De-Stress Revitalize Strategies to avoid feeling tired, bloated, and stressed out. How Fo...
http://webmd.com/women/fight-fatigue-bloat-stress-9/food-mood-boosters?page=2
*  Food Poisoning
... ABOUT BROWARD HEALTH. Home / Kids Health Kids Health. Managing Your Medical Care. Food Poisoning. What Is Food Poisoning. Do I Have Food Poisoning. No one put poison in your food, but bacteria probably grew in the food in the fridge and those bacteria made you sick. Food poisoning comes from eating foods that contain germs like bad bacteria or toxins, which are poisonous substances. You may have had mild food poisoning with diarrhea and an upset stomach but your mom or dad just called it a stomach bug or stomach virus. Bacteria are all around us, including in food, and sometimes they can be good for us. Foods from animals, raw foods, and unwashed vegetables all can contain germs that cause food poisoning. have an upset stomach called nausea, say: NAW-zee-uh have stomach cramps have diarrhea say: dye-uh-REE-uh, which may contain blood have a fever Sometimes feeling sick from food poisoning shows up within hours of eating the bad food. With mild cases of food poisoning, you will not feel sick for very long...
http://kidshealth.org/PageManager.jsp?dn=Chris_Evert_Childrens_Hospital&lic=306&cat_id=20080&article_set=22037&tracking=K_RelatedArticle
*  Food Poisoning
Common Food Poisoning Germs. After eating germ-infected food, a person can develop sudden and severe symptoms like vomiting and diarrhea. When people need medical treatment for food poisoning, it's often because of dehydration, which is the most common serious complication of food poisoning. Often, people get food poisoning from animal-based foods like meat, poultry, eggs, dairy products, and seafood. But unwashed fruits, vegetables, and other raw foods also can get contaminated and make someone sick. Water that is used to grow food can become infected with animal or human feces poop. Foods can become infected with bacteria if they're stored at the wrong temperature or kept too long. These bacteria usually get into foods when they come into contact with animal feces. E coli bacteria, too, usually get into food or water when they come into contact with animal feces. These bacteria are mostly found in unpasteurized dairy products, smoked seafood, and processed meats like hot dogs and luncheon meats. Listeria ba...
http://kidshealth.org/PageManager.jsp?dn=ChildrensPhysicianNetwork&lic=142&cat_id=20048&article_set=84622&ps=104
*  Food Poisoning
Common Food Poisoning Germs. When people need medical treatment for food poisoning, it's often because of dehydration, which is the most common serious complication of food poisoning. Often, people get food poisoning from animal-based foods like meat, poultry, eggs, dairy products, and seafood. But unwashed fruits, vegetables, and other raw foods also can get contaminated and make someone sick. Water that is used to grow food can become infected with animal or human feces poop. Foods can become infected with bacteria if they're stored at the wrong temperature or kept too long. These bacteria usually get into foods when they come into contact with animal feces. E coli bacteria, too, usually get into food or water when they come into contact with animal feces. These bacteria are mostly found in unpasteurized dairy products, smoked seafood, and processed meats like hot dogs and luncheon meats. Listeria bacteria also can contaminate fruits and vegetables, although that's less common. As with other kinds of bacter...
http://kidshealth.org/PageManager.jsp?dn=PrimaryChildrensHospital&lic=5&cat_id=20028&article_set=84622&ps=104
*  FIT Connection for Teens: Food
... Fit JR. Fit Kids. Fit Teen. food. move. mood. recharge. + food. food. move. mood. recharge. Articles. FIT Connection for Teens: Food How does eating tie in with being fit. By Brenda Conaway WebMD Feature Reviewed by William Fredette, MD. WebMD Archive. As one of the four pillars of the FIT Platform, FOOD provides the essential building blocks for your body. But the food choices you make every day affect the other areas of the FIT Platform, too. How FOOD Fits in With the Overall FIT Platform FOOD gives you energy to MOVE. A healthier choice would be a high-fiber snack with some protein, such as a few whole wheat crackers with low-fat cheese. Another food choice that is a MOVE-crusher is indulging in a big, heavy meal. A lighter meal might help you have more energy for a relaxing walk. FOOD can influence your MOOD and emotional health. Unfortunately, the FOOD-MOOD connection may not be what you'd hoped for. Comfort food is called that for a reason -- people often crave big meals or sweets when they need an...
http://fit.webmd.com/teen/food/article/teen-fit-connection-food
*  Food Poisoning
Common Food Poisoning Germs. What Are the Signs of Food Poisoning. Taking Care of Food Poisoning at Home. Most of the time, doctors use "food poisoning" to describe an illness that comes on quickly after eating contaminated food. When people eat or drink something that's contaminated with germs, they can get sick with food poisoning. Often, people get food poisoning from animal-based foods like meat, poultry, eggs, dairy products, and seafood. But unwashed fruits, vegetables, and other raw foods also can get contaminated and make people sick. Foods can become infected with bacteria if they're stored at the wrong temperature or kept too long. These bacteria usually get into foods when they come into contact with animal feces. E coli bacteria, too, typically get into food or water when they come into contact with animal feces. These bacteria are mostly found in unpasteurized dairy products, smoked seafood, and processed meats like hot dogs and luncheon meats. As with other kinds of bacteria, these usually get i...
http://kidshealth.org/PageManager.jsp?dn=PrimaryChildrensMedicalCenter&lic=5&cat_id=20174&article_set=84626&ps=204
*  .. Rising Food Prices: What Does It Mean for Paleo Folks? .. Rate this: .. Don't worry, they'll lo
Rising Food Prices: What Does It Mean for Paleo Folks. 02/28/2011 by PaleoPeriodical. The news lately has been full of headlines about the rising costs of food and the expectations that it’s only going to get worse. Demand for groceries is rising in places like India and China., dairy depending on how you Paleo/Primal, meat Zoinks., produce I think I’m numb by now…, cooking oils break out the home-rendered bacon fat, and sweets Finally some good news. harder to find local, 100% grass-fed and pastured animal protein sources. Unfortunately, this doesn’t bode well for chicken or eggs, since almost all suppliers I’ve been able to find use corn and soy in their feed. You probably already do, seeing as how it’s hard to find places that cater to our particular dietary principles. I feel fortunate to live in an area with such easy access to local produce, meat, and eggs, and this just reinforces my resolve to shop locally. Something that worries me, however, is that even local prices will be affected somehow, perhaps...
http://paleoperiodical.com/2011/02/28/rising-food-prices-what-does-it-mean-for-paleo-folks/
*  food food | Latest news on food food | food food photos - Rediff Realtime News Search
food food. Latest news on food food. food food photos - Rediff Realtime News Search. India As It Happens. Thank you for your feedback. Did you find Realtime News useful. rediff.com. India As It Happens. News. Images. What do you think of Realtime News. About 1384 results for "food food". NDTV, 44 minutes ago. 130,579 images for food food. Howard County Times, 1 day ago. Picton County Weekly, 16 hours ago. Howard County Times, 1 day ago. Howard County Times, 1 day ago. Howard County Times, 1 day ago. CTV News, 1 week ago. 130,579 images for food food. FoodWorks program at the Maryland Food Bank Howard County Times, 1 day ago. Times of India. Times of India, 1 hour ago. NDTV, 1 hour ago. First Post.com, 2 hours ago. Truckers stir may raise essential food items' prices by 15%: Assocham The industry body said the nationwide indefinite strike has already affected about 20 billion tonnes-km of freight traffic movement. NEW DELHI: As transporters' nationwide strike entered the fifth day today, industry chamber Assoc...
http://realtime.rediff.com/news/food--food
*  Reasons for Delaying the Introduction of Solid Foods to Babies | Parenting Patch
Reasons for Delaying the Introduction of Solid Foods to Babies. Reasons for Delaying the Introduction of Solid Foods to Babies January 21, 2012 by Heather Johnson. Pureed foods aside, until she acquires a number of teeth, I will not be introducing any solid foods but will continue to exclusively breastfeed her. In addition to a lack of teeth, young babies have a tongue-thrust reflex. Introducing solid foods into the mouth will just prompt a baby to push the food forward and out with his or her tongue. As well as lacking teeth and having the tongue-thrust reflex, young babies also lack the ability to properly swallow substances other than breast milk. As well as lowering the immunity protection of breast milk, introducing solid foods into an immature intestinal tract also increases the risk of iron-deficiency anemia. As I explored a few days ago, something as simple as giving a baby iron supplements reduces his or her ability to absorb the iron in breast milk properly. If protecting Poppy is as easy as not giv...
http://parentingpatch.com/reasons-for-delaying-the-introduction-of-solid-foods-to-babies/
*  Food Products
... Markets. Pre-Markets. Asia Video. Europe Video. CNBC U.S. CNBC Europe. CNBC World. Food and Beverage Food Products featured General Mills finds listeria in 2nd batch of green beans Friday, 2 Oct 2015. 1:25 PM ET In a new measure, food companies will be asked to label their products as "blend" if sweeteners are added to honey, in an effort to regulate food. Rising food prices mean changes for summer barbecues Friday, 28 Mar 2014. CNBC's Jane Wells reports Dean Foods and Hershey are among the stocks with the most exposure to milk commodity prices. 2:51 PM ET Discussing top consumer product and food stock picks as companies navigate weather and higher costs, with David Palmer and Nik Modi of RBC Capital Markets. 2:49 PM ET CNBC's Courtney Reagan reports from the RBC Capital Markets Consumer and Retail conference on Petsmart's weather troubles, and Texas Roadhouse facing higher beef prices. 5:43 PM ET Food prices are expected to rises this year, but Tyson CEO Donnie Smith said it won't stop his firm from pos...
http://cnbc.com/food-products/?page=32
*  Phoenix Food Project
... Building Community. Sharing Food. Who Gets the Food. Donate Food. Collect Food. Help in Other Ways Hunger in America. Contact Us. Neighborhood Diaper Bank website. Welcome to the Phoenix Food Project. The Phoenix Food Project is a revolutionary way to collect food: It's a donor drive, not a food drive. Instead of asking for one-time contributions of food, our volunteers Neighborhood Coordinators enlist their neighbors to become long-term Food Donors. What's the Food Project about. Neighbors donate a bag of food every two months. It's incredibly easy, because we supply the bag…and we pick up the food. We have collected more than 12,000 pounds of non-perishables for the Phoenix Food Pantry since our small beginning in Febr 2011…one bag at a time. The congregation and pantry workers fill in needs the last Sunday of each month, and by shopping for much needed proteins like peanut butter and canned tuna with funds donated by Green Bag participants who just got too busy to shop... Whether you donate food, coll...
http://phoenixfoodproject.org/

PRX-07034: PRX-07034 is a selective 5-HT6 receptor antagonist. It has cognition and memory-enhancing properties and potently decreases food intake and body weight in rodents.Banquet Foods: Banquet Foods is a subsidiary of ConAgra Foods that sells various food products, including frozen pre-made entrées, meals, and desserts.Dry matter: The dry matter (or otherwise known as dry weight) is a measurement of the mass of something when completely dried.Protein toxicity: Protein toxicity with proteinuria can result in those with preexisting kidney disease, or those who have lost kidney function due to age.Glycine soja: Glycine soja, or wild soybean (previously G. ussuriensis) is an annual plant in the legume family.Polymeal: The Polymeal is a diet-based approach to combatting heart disease, proposed in December 2004 by Oscar Franco, a Colombian public health scientist at the University Medical Centre in Rotterdam, Netherlands. Franco and his colleagues suggest the "Polymeal" as a natural alternative to the "Polypill", a multi-drug-based strategy for reducing heart disease.Carbohydrate loading: Carbohydrate loading, commonly referred to as carb-loading or carbo-loading, is a strategy used by endurance athletes, such as marathon runners, to maximize the storage of glycogen (or energy) in the muscles and liver.http://www.Sensory-specific satiety: Sensory-specific satiety is a sensory hedonic phenomenon that refers to the declining satisfaction generated by the consumption of a certain type of food, and the consequent renewal in appetite resulting from the exposure to a new flavor or food.Raynor H, Epstein L.Mayo Clinic Diet: The Mayo Clinic Diet is a diet created by Mayo Clinic. Prior to this, use of that term was generally connected to fad diets which had no association with Mayo Clinic.Protein Digestibility Corrected Amino Acid Score: Protein digestibility-corrected amino acid score (PDCAAS) is a method of evaluating the protein quality based on both the amino acid requirements of humans and their ability to digest it. The PDCAAS rating was adopted by the US Food and Drug Administration (FDA) and the Food and Agricultural Organization of the United Nations/World Health Organization (FAO/WHO) in 1993 as "the preferred 'best'" method to determine protein quality.Animal fatList of countries by food energy intake: Food consumption refers to the amount of food available for human consumption as estimated by the FAO Food Balance Sheets. However the actual food consumption may be lower than the quantity shown as food availability depending on the magnitude of wastage and losses of food in the household, e.Hunger (motivational state): Hunger is a sensationBlood glucose monitoring: Blood glucose monitoring is a way of testing the concentration of glucose in the blood (glycemia). Particularly important in the care of diabetes mellitus, a blood glucose test is performed by piercing the skin (typically, on the finger) to draw blood, then applying the blood to a chemically active disposable 'test-strip'.Specific appetite: Specific appetite, also known as specific hunger, is a drive to eat foods with specific flavors or other characteristics.School meal programs in the United States: School meal programs in the United States provide school meals freely, or at a subsidized price, to the children of low income families. These free or reduced meals have the potential to increase household food security, which can improve children's health and expand their educational opportunities.Southern corn leaf blight: Southern corn leaf blight (SCLB) is a fungal disease of maize caused by the plant pathogen Bipolaris maydis (also known as Cochliobolus heterostrophus in its teleomorph state).Insulin signal transduction pathway and regulation of blood glucose: The insulin transduction pathway is an important biochemical pathway beginning at the cellular level affecting homeostasis. This pathway is also influenced by fed versus fasting states, stress levels, and a variety of other hormones.Micronutrient Fortification Programs: The 2002 farm bill (P.L.Complete Wheat Bran Flakes: Kellogg's Complete Wheat Bran Flakes is a breakfast cereal containing 100% of the United States' Recommended Dietary Allowance of eleven vitamins and minerals, including vitamins B1, B3, B5, B6, B12, C, E, and Iron, Riboflavin, Folic Acid, and Zinc. One 3/4 cup serving contains 3 grams of protein, 5 grams of dietary fiber and 90 calories, 5 of which come from fat.Subtherapeutic antibiotic use in swine: Antibiotics are commonly used in commercial swine production in the United States and around the world. They are used for disease treatment, disease prevention and control, and growth promotion.First pass effect: The first-pass effect (also known as first-pass metabolism or presystemic metabolism) is a phenomenon of drug metabolism whereby the concentration of a drug is greatly reduced before it reaches the systemic circulation. It is the fraction of drug lost during the process of absorption which is generally related to the liver and gut wall.Cottonseed oil: Cottonseed oil is a cooking oil extracted from the seeds of cotton plants of various species, mainly Gossypium hirsutum and Gossypium herbaceum, that are grown for cotton fiber, animal feed, and oil.http://cotton.Stomach diseaseMenu FoodsNitrogen deficiencySave Me (Wake Up Call)CholecystokininProteinogenic amino acid: Proteinogenic amino acids are amino acids that are precursors to proteins, and are incorporated into proteins cotranslationally — that is, during translation. There are 23 proteinogenic amino acids in prokaryotes (including N-Formylmethionine, mainly used to initiate protein synthesis and often removed afterward), but only 21 are encoded by the nuclear genes of eukaryotes.Phytic acidCrustless bread: Crustless bread is bread without crusts. Panko is made from such a bread, which is produced by passing an electric current through the dough.Low-glycemic diet: A low-glycemic diet is one that selects foods on the basis of minimal alteration of circulating glucose levels. Glycemic index (GI) and glycemic load (GL) are measures of the effect on blood glucose level after a food containing carbohydrates is consumed.Index of energy articles: This is an index of energy articles.White meat: White meat or light meat refers to the lighter-colored meat of poultry as contrasted with dark meat. In a more general sense, white meat may also refer to any lighter-colored meat, as contrasted with red meats like beef and some types of game.TriglycerideTemporal analysis of products: Temporal Analysis of Products (TAP), (TAP-2), (TAP-3) is an experimental technique for studyingMonogastric: A monogastric organism has a simple single-chambered stomach, compared with a ruminant organism, like a cow, goat, or sheep, which has a four-chambered complex stomach. Examples of monogastric animals include omnivores such as humans, rats, dogs and pigs, and carnivores such as cats, and herbivores such as horses and rabbits.Gastric inhibitory polypeptide: Gastric inhibitory polypeptide (GIP), also known as the glucose-dependent insulinotropic peptide is a member of the secretin family of hormones.Red Feather Development Group: Red Feather Development Group is a non-profit organization that builds straw-bale homes on American Indian reservations.General Mills monster-themed breakfast cerealsGlucagon-like peptide-2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).Lunasin: Lunasin is a peptide found in soy and some cereal grains, which has been the subject of research since 1996 focusing on cancer, cholesterol and cardiovascular disease and inflammation.Vegetable juiceBeef cattle: Beef cattle are cattle raised for meat production (as distinguished from dairy cattle, used for milk production). The meat of adult cattle is known as beef.Lactic acid fermentationDietary Supplements (database): The PubMed Dietary Supplement Subset (PMDSS) is a joint project between the National Institutes of Health (NIH) National Library of Medicine (NLM) and the NIH Office of Dietary Supplements (ODS). PMDSS is designed to help people search for academic journal articles related to dietary supplement literature.Isotopes of iron: Naturally occurring iron (Fe) consists of four isotopes: 5.845% of 54Fe (possibly radioactive with a half-life over 3.Starch gelatinization: Starch gelatinization is a process of breaking down the intermolecular bonds of starch molecules in the presence of water and heat, allowing the hydrogen bonding sites (the hydroxyl hydrogen and oxygen) to engage more water. This irreversibly dissolves the starch granule in water.Molasses: Molasses, or black treacle (British, for human consumption; known as molasses otherwise), is a viscous by-product of the refining of sugarcane or sugar beets into sugar. The word comes from the Proto-Indo-European *mélid".Casein: Casein ( or , from Latin caseus, "cheese") is the name for a family of related phosphoproteins (αS1, αS2, β, κ). These proteins are commonly found in mammalian milk, making up 80% of the proteins in cow milk and between 20% and 45% of the proteins in human milk.Monosodium phosphateSports drink: Sports drinks are beverages whose stated purpose is to help athletes replace water, electrolytes, and energy after training or competition, though their efficacy for that purpose has been questioned, particularly after exercise which is only moderate.Classification of obesity: Obesity is a medical condition in which excess body fat has accumulated to the extent that it has an adverse effect on health.WHO 2000 p.Diabetic diet: Diabetic diet refers to the diet that is recommended for people with diabetes mellitus, or high blood glucose. There is much disagreement regarding what this diet should consist of.Erythromycin breath test: The erythromycin breath test (ERMBT) is a method used to measure metabolism (oxidation and elimination from the system) by a part of the cytochrome P450 system. Erythromycin is tagged with carbon-14 and given as an intravenous injection; after 20 minutes the subject blows up a balloon and the carbon dioxide exhaled that is tagged with carbon-14 shows the activity of the CYP3A4 isoenzyme on the erythromycin.Little gastrin IProteose: A proteose is any of various water-soluble compounds that are produced during digestion by the hydrolytic breakdown of proteins short of the amino acid stage.[1]Renal functionGentle frying: Gentle frying or low-temperature frying is an oil- or fat-based cooking method used for relatively fragile or starchy foods.fissler.Unifine mill: A Unifine mill is a single one-pass impact milling system which produces ultrafine-milled whole-grain wheat flour that requires no grain pre-treatment and no screening of the flour. Like the grist or stone mills that had dominated the flour industry for centuries, the bran, germ, and endosperm elements of grain are processed into a nutritious whole wheat flour in one step.Wheat middlings: Wheat middlings (also known as millfeed, wheat mill run, or wheat midds) is the middle of three grades into which flour and meal are classified: patents, middlings, and clears. Middlings are often used in animal feed.Gastrointestinal physiology: Gastrointestinal physiology is a branch of human physiology addressing the physical function of the gastrointestinal (GI) system. The major processes occurring in the GI system are that of motility, secretion, regulation, digestion and circulation.

(1/105) Using individualized reinforcers and hierarchical exposure to increase food flexibility in children with autism spectrum disorders.

 (+info)

(2/105) Does involvement in food preparation track from adolescence to young adulthood and is it associated with better dietary quality? Findings from a 10-year longitudinal study.

 (+info)

(3/105) The effect of lipid droplet size on satiety and peptide secretion is intestinal site-specific.

 (+info)

(4/105) Leucine supplementation chronically improves muscle protein synthesis in older adults consuming the RDA for protein.

 (+info)

(5/105) Oxytocin prolongs the gastric emptying time in patients with diabetes mellitus and gastroparesis, but does not affect satiety or volume intake in patients with functional dyspepsia.

 (+info)

(6/105) Food motivation circuitry hypoactivation related to hedonic and nonhedonic aspects of hunger and satiety in women with active anorexia nervosa and weight-restored women with anorexia nervosa.

 (+info)

(7/105) Results from an experimental trial at a Head Start center to evaluate two meal service approaches to increase fruit and vegetable intake of preschool aged children.

 (+info)

(8/105) Overweight and obese humans overeat away from home.

 (+info)