Lactoferrin
An iron-binding protein that was originally characterized as a milk protein. It is widely distributed in secretory fluids and is found in the neutrophilic granules of LEUKOCYTES. The N-terminal part of lactoferrin possesses a serine protease which functions to inactivate the TYPE III SECRETION SYSTEM used by bacteria to export virulence proteins for host cell invasion.
Transferrin
Iron
Milk, Human
Neutrophils
Muramidase
A basic enzyme that is present in saliva, tears, egg white, and many animal fluids. It functions as an antibacterial agent. The enzyme catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. EC 3.2.1.17.
Apoproteins
Neutralization of endotoxin in vitro and in vivo by a human lactoferrin-derived peptide. (1/1197)
Endotoxin (lipopolysaccharide [LPS]) is the major pathogenic factor of gram-negative septic shock, and endotoxin-induced death is associated with the host overproduction of tumor necrosis factor alpha (TNF-alpha). In the search for new antiendotoxin molecules, we studied the endotoxin-neutralizing capacity of a human lactoferrin-derived 33-mer synthetic peptide (GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP; designated LF-33) representing the minimal sequence for lactoferrin binding to glycosaminoglycans. LF-33 inhibited the coagulation of the Limulus amebocyte lysate and the secretion of TNF-alpha by RAW 264.7 cells induced by lipid A and four different endotoxins with a potency comparable to that of polymyxin B. The first six residues at the N terminus of LF-33 were critical for its antiendotoxin activity. The endotoxin-neutralizing capacity of LF-33 and polymyxin B was attenuated by human serum. Coinjection of Escherichia coli LPS (125 ng) with LF-33 (2.5 microg) dramatically reduced the lethality of LPS in the galactosamine-sensitized mouse model. Significant protection of the mice against the lethal LPS challenge was also observed when LF-33 (100 microg) was given intravenously after intraperitoneal injection of LPS. Protection was correlated with a reduction in TNF-alpha levels in the mouse serum. These results demonstrate the endotoxin-neutralizing capability of LF-33 in vitro and in vivo and its potential use for the treatment of endotoxin-induced septic shock. (+info)The binding of human lactoferrin to mouse peritoneal cells. (2/1197)
Human iron-saturated Lf (FeLf), which was labeled with 125I or 50Fe, was found to combine with the membrane of mouse peritoneal cells (MPC) which consisted of 70% macrophages. The following experimental data suggested the involvement of a specific receptor. (a) The binding of FeLf to MPC reached a saturation point. (b) The binding of radioactive FeLf was inhibited by preincubating the cells with cold FeLf but not with human Tf, human aggregated and nonaggregated IgG, or beef heart cytochrome c (c) Succinylation and carbamylation of FeLf resulted in a loss of its inhibiting activity on the binding of radioactive FeLf. Removal of neuraminic acid from FeLf increased its inhibitory activity. (d) The ability of apoLf to inhibit the binding of FeLf to MPC was significantly lower than that of FeLf. The existence of a Lf receptor capable of concentrating Lf released from neutrophils on the membrane of macrophages could explain the apparent blockade of the release of iron from the reticuloendothelial system, which accounts for the hyposideremia of inflammation. A receptor for FeLf was also found on mouse peritoneal lymphocytes. The affinity constant of FeLf for both lymphocytes and macrophages was 0.9 X 12(6) liter/mol. Howerver, macrophages bound three times more FeLf molecules (20 X 10(6)) per cell than did lymphocytes (7 X 10(6)). (+info)Receptor-mediated transcytosis of lactoferrin through the blood-brain barrier. (3/1197)
Lactoferrin (Lf) is an iron-binding protein involved in host defense against infection and severe inflammation; it accumulates in the brain during neurodegenerative disorders. Before determining Lf function in brain tissue, we investigated its origin and demonstrate here that it crosses the blood-brain barrier. An in vitro model of the blood-brain barrier was used to examine the mechanism of Lf transport to the brain. We report that differentiated bovine brain capillary endothelial cells exhibited specific high (Kd = 37.5 nM; n = 90,000/cell) and low (Kd = 2 microM; n = 900,000 sites/cell) affinity binding sites. Only the latter were present on nondifferentiated cells. The surface-bound Lf was internalized only by the differentiated cell population leading to the conclusion that Lf receptors were acquired during cell differentiation. A specific unidirectional transport then occurred via a receptor-mediated process with no apparent intraendothelial degradation. We further report that iron may cross the bovine brain capillary endothelial cells as a complex with Lf. Finally, we show that the low density lipoprotein receptor-related protein might be involved in this process because its specific antagonist, the receptor-associated protein, inhibits 70% of Lf transport. (+info)Purification of a 76-kDa iron-binding protein from human seminal plasma by affinity chromatography specific for ribonuclease: structural and functional identity with milk lactoferrin. (4/1197)
A pink-colored iron-binding protein has been found in large amount in human seminal plasma and identified as a lactoferrin isoform. Its purification, by a modification of a three-step chromatography procedure developed in an attempt to purify a ribonuclease from the same fluid, provided about 15-18 mg of pure protein from 100 ml of seminal plasma. Despite its ability to bind a ribonuclease ligand during the affinity step, the iron-binding protein did not display any detectable RNase activity in a standard assay with yeast RNA as substrate. It showed an apparent molecular weight of 76 kDa and resulted to be quite similar, if not identical, to human milk lactoferrin in many respects. Its N-terminal sequence (31 amino acid residues) starting with Arg-3 was identical to that of one of the N-terminally truncated lactoferrin variants isolated from human milk. Moreover, the amino acid sequence of a number of peptides, which represented about 23% of the entire sequence, has been also shown to be identical to that of the corresponding peptides of human milk lactoferrin. Double diffusion analysis revealed full recognition by antibodies anti-human milk lactoferrin of the human seminal plasma protein. Using immunoblotting analysis, both human milk lactoferrin and human seminal protein were recognized by antibodies anti-milk lactoferrin. When tested for its iron binding capacity, with Fe-NTA as iron donor, the protein purified was able to bind iron up to 100% saturation, as judged by absorbance at 465 nm. (+info)Identification of pneumococcal surface protein A as a lactoferrin-binding protein of Streptococcus pneumoniae. (5/1197)
Lactoferrin (Lf), an iron-sequestering glycoprotein, predominates in mucosal secretions, where the level of free extracellular iron (10(-18) M) is not sufficient for bacterial growth. This represents a mechanism of resistance to bacterial infections by prevention of colonization of the host by pathogens. In this study we were able to show that Streptococcus pneumoniae specifically recognizes and binds the iron carrier protein human Lf (hLf). Pretreatment of pneumococci with proteases reduced hLf binding significantly, indicating that the hLf receptor is proteinaceous. Binding assays performed with 63 clinical isolates belonging to different serotypes showed that 88% of the tested isolates interacted with hLf. Scatchard analysis showed the existence of two hLf-binding proteins with dissociation constants of 5.7 x 10(-8) and 2.74 x 10(-7) M. The receptors were purified by affinity chromatography, and internal sequence analysis revealed that one of the S. pneumoniae proteins was homologous to pneumococcal surface protein A (PspA). The function of PspA as an hLf-binding protein was confirmed by the ability of purified PspA to bind hLf and to competitively inhibit hLf binding to pneumococci. S. pneumoniae may use the hLf-PspA interaction to overcome the iron limitation at mucosal surfaces, and this might represent a potential virulence mechanism. (+info)The structure of the antimicrobial active center of lactoferricin B bound to sodium dodecyl sulfate micelles. (6/1197)
Lactoferricin B (LfcinB) is a 25-residue antimicrobial peptide released from bovine lactoferrin upon pepsin digestion. The antimicrobial center of LfcinB consists of six residues (RRWQWR-NH2), and it possesses similar bactericidal activity to LfcinB. The structure of the six-residue peptide bound to sodium dodecyl sulfate (SDS) micelles has been determined by NMR spectroscopy and molecular dynamics refinement. The peptide adopts a well defined amphipathic structure when bound to SDS micelles with the Trp sidechains separated from the Arg residues. Additional evidence demonstrates that the peptide is oriented in the micelle such that the Trp residues are more deeply buried in the micelle than the Arg and Gln residues. (+info)Endothelial activation response to oral micronised flavonoid therapy in patients with chronic venous disease--a prospective study. (7/1197)
BACKGROUND: Endothelial activation is important in the pathogenesis of skin changes due to chronic venous disease (CVD). Purified micronised flavonoid fraction has been used for symptomatic treatment of CVD for a considerable period of time. The exact mode of action of these compounds remains unknown. AIM: To study the effects of micronised purified flavonoidic fraction (Daflon 500 mg, Servier, France) treatment on plasma markers of endothelial activation. MATERIALS AND METHODS: Twenty patients with chronic venous disease were treated for 60 days with DAFLON 500 mg twice daily. Duplex ultrasonography and PPG was used to assess the venous disease. Blood was collected from a foot vein immediately before starting treatment and within 1 week of stopping treatment. Plasma markers of endothelial activation were measured using commercial ELISA kits. RESULTS: Reduction in the level of ICAM-1, 32% (141 ng/ml: 73 ng/ml) and VCAM 29% (1292 ng/ml: 717 ng/ml) was seen. Reduction in plasma lactoferrin (36% decrease, 760 ng/ml: 560 ng/ml) and VW factor occurred in the C4 group only. CONCLUSIONS: Micronised purified flavonoidic fraction treatment for 60 days seems to decrease the levels of some plasma markers of endothelial activation. This could ameliorate the dermatological effects of (CVD). This could also explain some of the pharmacological actions of these compounds. Our study demonstrates the feasibility of using soluble endothelial adhesion molecules as markers for treatment. (+info)Recovery of 15N-lactoferrin is higher than that of 15N-casein in the small intestine of suckling, but not adult miniature pigs. (8/1197)
Performance of biological functions of lactoferrin in the small intestine requires at least some resistance to degradation. Therefore, we studied prececal digestibility of lactoferrin in comparison to casein both in suckling and adult miniature pigs, applying 15N-labeled proteins. In study 1, 43 piglets (10-d-old), deprived of food for 12 h received 10 mL of sow's milk supplemented with 120 mg of 15N-labeled protein (porcine or bovine lactoferrin or bovine casein). Piglets were anesthetized 150 min later, after which the small intestine was excised, cut into three sections, and chyme was collected. In study 2, nine food-deprived boars fitted with T-canulae at the terminal ileum were given two semisynthetic experimental meals (204 g) in a cross-over design, 2 wk apart. One contained 7.5% (g/100 g) 15N-labeled bovine casein, the other 1.25% 15N-labeled bovine lactoferrin. Both were adjusted to 15% total protein with nonlabeled casein. Ileal chyme was collected from the canula over 33 h postprandially. All diets contained the indigestible marker chromic oxide. 15N-digestibility of lactoferrin, both porcine (84.4 +/- 3.2%) and bovine (82.3 +/- 4.8%), was significantly lower than casein digestibility (97.6 +/- 0.5%) in the distal small intestine of suckling piglets (P < 0.05). Based on immunoblotting after acrylamide electrophoresis, 4.5% of non- and partially digested lactoferrin was found in the last third of the small intestine of piglets. In adult miniature pigs there was no difference in 15N-digestibility of bovine lactoferrin compared to bovine casein (90.7 +/- 1.9% vs. 93.9 +/- 1.0%, P > 0.05). In suckling miniature pigs, the reduced digestibility of lactoferrin may provide the prerequisite for biological actions along the whole intestinal tract. The source of lactoferrin, porcine or bovine, made no difference in this respect. (+info)Lactoferrin is an iron-binding glycoprotein found in various exocrine secretions, such as milk, tears, and saliva, with multifunctional roles including antibacterial, antiviral, and immunomodulatory activities.
Lactoferrin is a glycoprotein that belongs to the transferrin family. It is an iron-binding protein found in various exocrine secretions such as milk, tears, and saliva, as well as in neutrophils, which are a type of white blood cell involved in immune response. Lactoferrin plays a role in iron homeostasis, antimicrobial activity, and anti-inflammatory responses. It has the ability to bind free iron, which can help prevent bacterial growth by depriving them of an essential nutrient. Additionally, lactoferrin has been shown to have direct antimicrobial effects against various bacteria, viruses, and fungi. Its role in the immune system also includes modulating the activity of immune cells and regulating inflammation.
Lactoglobulins are a type of protein found in whey, a byproduct of cheese production, and are often used as a marker for milk allergen in food products and medical testing.
Lactoglobulins, specifically referring to β-lactoglobulin, are a type of protein found in the whey fraction of milk from ruminant animals such as cows and sheep. They are one of the major proteins in bovine milk, making up about 10% of the total protein content.
β-lactoglobulin is a small, stable protein that is resistant to heat and acid denaturation. It has an important role in the nutrition of young mammals as it can bind to fat molecules and help with their absorption. In addition, β-lactoglobulin has been studied for its potential health benefits, including its antioxidant and anti-inflammatory properties.
However, some people may have allergies to β-lactoglobulin, which can cause symptoms such as hives, swelling, and difficulty breathing. In these cases, it is important to avoid foods that contain this protein.
Transferrin is a glycoprotein that binds and transports iron ions in the blood to maintain iron homeostasis, protect against iron-induced oxidative stress, and deliver iron for erythropoiesis.
Transferrin is a glycoprotein that plays a crucial role in the transport and homeostasis of iron in the body. It's produced mainly in the liver and has the ability to bind two ferric (Fe3+) ions in its N-lobe and C-lobe, thus creating transferrin saturation.
This protein is essential for delivering iron to cells while preventing the harmful effects of free iron, which can catalyze the formation of reactive oxygen species through Fenton reactions. Transferrin interacts with specific transferrin receptors on the surface of cells, particularly in erythroid precursors and brain endothelial cells, to facilitate iron uptake via receptor-mediated endocytosis.
In addition to its role in iron transport, transferrin also has antimicrobial properties due to its ability to sequester free iron, making it less available for bacterial growth and survival. Transferrin levels can be used as a clinical marker of iron status, with decreased levels indicating iron deficiency anemia and increased levels potentially signaling inflammation or liver disease.
Iron, in the context of human health, is an essential dietary micromineral and a key component of hemoglobin, responsible for oxygen transport in the blood, which can also act as a crucial co-factor in various enzymatic reactions in the body.
In the context of medicine, iron is an essential micromineral and key component of various proteins and enzymes. It plays a crucial role in oxygen transport, DNA synthesis, and energy production within the body. Iron exists in two main forms: heme and non-heme. Heme iron is derived from hemoglobin and myoglobin in animal products, while non-heme iron comes from plant sources and supplements.
The recommended daily allowance (RDA) for iron varies depending on age, sex, and life stage:
* For men aged 19-50 years, the RDA is 8 mg/day
* For women aged 19-50 years, the RDA is 18 mg/day
* During pregnancy, the RDA increases to 27 mg/day
* During lactation, the RDA for breastfeeding mothers is 9 mg/day
Iron deficiency can lead to anemia, characterized by fatigue, weakness, and shortness of breath. Excessive iron intake may result in iron overload, causing damage to organs such as the liver and heart. Balanced iron levels are essential for maintaining optimal health.
'Human Milk' is the secretion from human mammary glands, primarily composed of water, carbohydrates, fats, proteins, and various bioactive components, which serves as the complete source of nutrition for newborn infants, supporting their growth, development, and immune system.
Human milk, also known as breast milk, is the nutrient-rich fluid produced by the human female mammary glands to feed and nourish their infants. It is the natural and species-specific first food for human babies, providing all the necessary nutrients in a form that is easily digestible and absorbed. Human milk contains a balance of proteins, carbohydrates, fats, vitamins, minerals, and other bioactive components that support the growth, development, and immunity of newborns and young infants. Its composition changes over time, adapting to meet the changing needs of the growing infant.
Neutrophils are a type of granulocytic white blood cell that constitute an essential part of the innate immune system, characterized by their multi-lobed nuclei and potent microbicidal activities, primarily functioning to engulf and destroy various pathogens through a process known as phagocytosis.
Neutrophils are a type of white blood cell that are part of the immune system's response to infection. They are produced in the bone marrow and released into the bloodstream where they circulate and are able to move quickly to sites of infection or inflammation in the body. Neutrophils are capable of engulfing and destroying bacteria, viruses, and other foreign substances through a process called phagocytosis. They are also involved in the release of inflammatory mediators, which can contribute to tissue damage in some cases. Neutrophils are characterized by the presence of granules in their cytoplasm, which contain enzymes and other proteins that help them carry out their immune functions.
Muramidase, also known as lysozyme, is an enzyme that catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine in peptidoglycans, a component of bacterial cell walls.
Muramidase, also known as lysozyme, is an enzyme that hydrolyzes the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamine in peptidoglycan, a polymer found in bacterial cell walls. This enzymatic activity plays a crucial role in the innate immune system by contributing to the destruction of invading bacteria. Muramidase is widely distributed in various tissues and bodily fluids, such as tears, saliva, and milk, and is also found in several types of white blood cells, including neutrophils and monocytes.
'Tears' are aqueous, lubricating solutions produced by the lacrimal glands, consisting of water, electrolytes, lipids, and proteins, that serve to cleanse, moisturize, and protect the ocular surface, while also playing a role in emotional expression.
In medical terms, "tears" are a clear, salty liquid that is produced by the tear glands (lacrimal glands) in our eyes. They serve to keep the eyes moist, protect against dust and other foreign particles, and help to provide clear vision by maintaining a smooth surface on the front of the eye. Tears consist of water, oil, and mucus, which help to prevent evaporation and ensure that the tears spread evenly across the surface of the eye. Emotional or reflexive responses, such as crying or yawning, can also stimulate the production of tears.
Apoproteins are proteins that bind and transport lipids in the blood, acting as structural or regulatory components of lipoprotein complexes such as LDL, HDL, and VLDL particles.
Apoproteins are the protein components of lipoprotein complexes, which are responsible for transporting fat molecules, such as cholesterol and triglycerides, throughout the body. Apoproteins play a crucial role in the metabolism of lipids by acting as recognition signals that allow lipoproteins to interact with specific receptors on cell surfaces.
There are several different types of apoproteins, each with distinct functions. For example, apolipoprotein A-1 (apoA-1) is the major protein component of high-density lipoproteins (HDL), which are responsible for transporting excess cholesterol from tissues to the liver for excretion. Apolipoprotein B (apoB) is a large apoprotein found in low-density lipoproteins (LDL), very low-density lipoproteins (VLDL), and lipoprotein(a). ApoB plays a critical role in the assembly and secretion of VLDL from the liver, and it also mediates the uptake of LDL by cells.
Abnormalities in apoprotein levels or function can contribute to the development of various diseases, including cardiovascular disease, diabetes, and Alzheimer's disease. Therefore, measuring apoprotein levels in the blood can provide valuable information for diagnosing and monitoring these conditions.
'Cattle' is not a term used in medical definitions; it is a domesticated bovine animal (Bos taurus or Bos indicus) primarily raised for meat, dairy, and hides, but it may appear in medical contexts related to zoonotic diseases, food safety, or allergies concerning this species.
"Cattle" is a term used in the agricultural and veterinary fields to refer to domesticated animals of the genus *Bos*, primarily *Bos taurus* (European cattle) and *Bos indicus* (Zebu). These animals are often raised for meat, milk, leather, and labor. They are also known as bovines or cows (for females), bulls (intact males), and steers/bullocks (castrated males). However, in a strict medical definition, "cattle" does not apply to humans or other animals.
Lactoferrin
Bovine lactoferrin has more activity against H. pylori than human lactoferrin. Lactoferrin in sufficient strength acts on a ... Ribonuclease-enriched lactoferrin has been used to examine how lactoferrin affects bone. Lactoferrin has shown to have positive ... Lactoferrin is also present in secondary granules of PMNs and is secreted by some acinar cells. Lactoferrin can be purified ... The lactoferrin receptor plays an important role in the internalization of lactoferrin; it also facilitates absorption of iron ...
Jillian Cornish
"Lactoferrin is a potent regulator of bone cell activity and increases bone formation in vivo." Endocrinology 145, no. 9 (2004 ... "Lactoferrin." U.S. Patent Application 10/205,960, filed 9 October 2003. Reid, Ian, Jillian Cornish, Neill Haggarty, and Kay ... "Lactoferrin-a novel bone growth factor." Clinical Medicine & Research 3, no. 2 (2005): 93-101. Cornish, Jillian, Ian Reginald ...
Glyceraldehyde 3-phosphate dehydrogenase
December 2015). "Secreted multifunctional Glyceraldehyde-3-phosphate dehydrogenase sequesters lactoferrin and iron into cells ... Lactoferrin; Apurinic/apyrimidinic endonuclease (APE1), thus converting oxidized APE1 to its reduced form, to restart its ...
Transferrin
... lactoferrin); milk transferrin; egg white ovotransferrin (conalbumin); and membrane-associated melanotransferrin. Beta-2 ...
Bega Group
"Our story - Bega Bionutrients , Lactoferrin Supplier". Bega Bionutrients , Lactoferrin Supplier. Retrieved 22 January 2017. ... such as lactoferrin and milk protein concentrate), which make up around 9% of revenue. In 2019, the company won a legal dispute ...
Lactoperoxidase
In combination with lactoferrin, lactoperoxidase combats halitosis; in combination with lactoferrin and lysozyme, ... August 2011). "Effects of a composition containing lactoferrin and lactoperoxidase on oral malodor and salivary bacteria: a ... Ekstrand B (1994). "Lactoperoxidase and lactoferrin". In Beuchat LR, Dillon VM, Board RG (eds.). Natural antimicrobial systems ... Reiter B (1983). "The biological significance of lactoferrin". International Journal of Tissue Reactions. 5 (1): 87-96. PMID ...
Iron-binding proteins
It is this specific combination that makes lactoferrin's iron affinity 300 times greater than transferrin. Lactoferrin has ... Lactoferrin is able to bind to the LPS (lipopolysaccharide) layer of bacteria, and in its holo form the iron atom oxidizes the ... Lactoferrin is a member of the transferrin family and is the predominant protein found in mammal exocrine secretions, such as ... It was widely believed that lactoferrin was only a bacteriostatic agent due to its high iron affinity and its ability to ...
Respiratory tract antimicrobial defense system
Lactoferrin with hypothiocyanite for the treatment of cystic fibrosis has been granted orphan drug status by the EMEA and the ... Lactoferrin (LF) is a multifunctional protein which is an essential part of the respiratory tract antimicrobial defense system ... Sánchez L, Calvo M, Brock JH (May 1992). "Biological role of lactoferrin". Arch. Dis. Child. 67 (5): 657-61. doi:10.1136/adc. ... Tomita M, Takase M, Bellamy W, Shimamura S (October 1994). "A review: the active peptide of lactoferrin". Acta Paediatr Jpn. 36 ...
Iron deficiency
Lactoferrin is also concentrated in tears, saliva and at wounds to bind iron to limit bacterial growth. Egg white contains 12% ... 30 Between 15 and 20 percent of the protein content in human milk consists of lactoferrin that binds iron. As a comparison, in ... Lactoferrin: Interactions and Biological Functions. Experimental Biology and Medicine. Totowa, NJ: Humana Press. p. 379. doi: ...
Gallium scan
Lactoferrin is contained within leukocytes. Gallium may bind to lactoferrin and be transported to sites of inflammation, or ... Gallium (III) (Ga3+) binds to transferrin, leukocyte lactoferrin, bacterial siderophores, inflammatory proteins, and cell- ... binds to lactoferrin released during bacterial phagocytosis at infection sites (and remains due to binding with macrophage ...
Intelectin-1
... , also known as omentin or intestinal lactoferrin receptor, is an intelectin encoded in humans by the ITLN1 gene. ... Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding ... Suzuki YA, Lopez V, Lönnerdal B (November 2005). "Mammalian lactoferrin receptors: structure and function". Cellular and ... "Molecular cloning and functional expression of a human intestinal lactoferrin receptor". Biochemistry. 40 (51): 15771-9. doi: ...
Breastfeeding
Czosnykowska-Łukacka, M.; Orczyk-Pawiłowicz, M.; Broers, B.; Królak-Olejnik, B. (2019). "Lactoferrin in Human Milk of Prolonged ... and lactoferrin (which binds to iron and inhibits the growth of intestinal bacteria). Exclusive breastfeeding until six months ... Breast milk is known to contain lactoferrin (Lf), which protects the infant from infection caused by a wide range of pathogens ...
Lactoferricin
It can be generated by the pepsin-mediated digestion of lactoferrin. Lactoferricin is the most studied AMP derived from milk ... In humans, lactoferricin corresponds to lactoferrin fragment 1-47 but consists of two subunits, namely fragments 1-11 and 12-47 ... Wakabayashi H, Takase M, Tomita M (2003). "Lactoferricin derived from milk protein lactoferrin" (PDF). Current Pharmaceutical ... Gifford JL, Hunter HN, Vogel HJ (November 2005). "Lactoferricin: a lactoferrin-derived peptide with antimicrobial, antiviral, ...
Extended breastfeeding
The amount of lactoferrin in breast milk increases significantly during the months of 12 through 24 and remains elevated for as ... Breast milk is known to contain lactoferrin (Lf), which protects the infant from infection caused by a wide range of pathogens ... Breast milk is known to contain lactoferrin, which protects the infant from infection caused by a wide range of pathogens. ... Czosnykowska-Łukacka, M.; Orczyk-Pawiłowicz, M.; Broers, B.; Królak-Olejnik, B. (2019). "Lactoferrin in Human Milk of Prolonged ...
Lipocalin 1
"Interaction of tear lipocalin with lysozyme and lactoferrin". Biochemical and Biophysical Research Communications. 265 (2): 322 ...
Metalloprotein
"Structure of human lactoferrin at 3.2-A resolution". Proceedings of the National Academy of Sciences of the United States of ...
Alpha defensin
Are defensins and lactoferrin elevated in preeclamptic patients?". The Journal of Reproductive Medicine. 42 (1): 29-32. PMID ...
Breastmilk medicine
Lactoferrin can interact directly with the F glycoprotein which is a protein on the surface of the virus that is responsible ... Lactoferrin in HBM can also inhibit the invasion and proliferation of respiratory syncytial virus (RSV), which is a virus ... Lactoferrin can prevent infection of adenovirus since it can interfere with the primary receptors of the virus. HBM ... Besides, lactoferrin protects infants against bacterial and fungal infections in combination with other peptides present in HBM ...
Salivary gland
For example, lactoferrin in saliva binds naturally with iron. Since iron is a major component of bacterial cell walls, removal ...
Bacteriology
Vogel L, Geluk F, Jansen H, Dankert J, van Alphen L (November 1997). "Human lactoferrin receptor activity in non-encapsulated ...
Genetically modified rice
Their most notable variety produces human Lactoferrin and Lysozyme. These two proteins are produced naturally in human breast ...
Ulcerative colitis
Lactoferrin is an additional nonspecific marker of intestinal inflammation. Overall, imaging tests, such as x-ray or CT scan, ... Inflammation in the intestine may also cause higher levels of fecal calprotectin or lactoferrin. Specific testing may include ... June 2015). "C-Reactive Protein, Fecal Calprotectin, and Stool Lactoferrin for Detection of Endoscopic Activity in Symptomatic ...
Mycoplasma bovis
Mastitis can cause a decline in potassium and lactoferrin. It also results in decreased casein, the major protein in milk. As ...
Kathryn Stowell
Stowell joined Massey University in 1976, after a 1990 PhD titled 'Cloning and expression of the cDNA for human lactoferrin,' ... "Expression of cloned human lactoferrin in baby-hamster kidney cells." Biochemical Journal 276, no. Pt 2 (1991): 349. Brown RL; ...
Neutrophil-specific granule deficiency
Lactoferrin is the major enzyme found in specific granules, and will be largely absent in the granulocytes of these patients, ... Breton-Gorius J, Mason DY, Buriot D, Vilde JL, Griscelli C (1980). "Lactoferrin deficiency as a consequence of a lack of ... Detection by immunoperoxidase staining for lactoferrin and cytochemical electron microscopy". Am. J. Pathol. 99 (2): 413-28. ... Neutrophil-specific granule deficiency ( previously known as lactoferrin deficiency) is a rare congenital immunodeficiency ...
Infant formula
Lactoferrin is a globular, multifunctional protein that has antimicrobial activity. Compared to human milk, cow's milk has a ... signifactly lower levels of lysozyme and lactoferrin; therefore, the industry has an increasing interest in adding them into ...
Clostridioides difficile infection
Vaishnavi C, Bhasin D, Kochhar R, Singh K (December 2000). "Clostridium difficile toxin and faecal lactoferrin assays in adult ... Stool leukocyte measurements and stool lactoferrin levels also have been proposed as diagnostic tests, but may have limited ...
Prevotella
Lactoferrin inhibits the growth of P. gingivalis but not Prevotella. Inorganic iron and iron-binding proteins such as ... These species were shown to bind lactoferrin that is released together with the contents of neutrophils during inflammation and ... "Evaluation of the antimicrobial effect of lactoferrin on Porphyromonas gingivalis, Prevotella intermedia and Prevotella ... transferrin and lactoferrin do not support the growth of P. intermedia, however hemin-iron-containing compounds which include ...
Cathepsin G
Komine K, Kuroishi T, Ozawa A, Komine Y, Minami T, Shimauchi H, Sugawara S (March 2007). "Cleaved inflammatory lactoferrin ...
Keratinocyte
July 2010). "Human lactoferrin stimulates skin keratinocyte function and wound re-epithelialization". The British Journal of ...
Lactoferrin - Wikipedia
Bovine lactoferrin has more activity against H. pylori than human lactoferrin. Lactoferrin in sufficient strength acts on a ... Ribonuclease-enriched lactoferrin has been used to examine how lactoferrin affects bone. Lactoferrin has shown to have positive ... Lactoferrin is also present in secondary granules of PMNs and is secreted by some acinar cells. Lactoferrin can be purified ... The lactoferrin receptor plays an important role in the internalization of lactoferrin; it also facilitates absorption of iron ...
TurtleTree Announces LF+, the First-Ever Sustainable Lactoferrin Made With Precision Fermentation
In pioneering the use of this technology for lactoferrin and its inclusion in food, TurtleTree is uniquely poised to be a ... In a 2022 review, researchers from Poland highlighted a fascinating function of lactoferrin as a guardian of the human genome, ... From immune support to gut health, lactoferrin has been shown to provide an extensive list of health-related benefits." ... This adds to a growing volume of scientific literature that has already shown lactoferrins ability to modulate immune ...
Activated Lactoferrin-A New Approach to Meat Safety - IFT.org
Influence of lactoferrin on host-microbe interactions. In "Lactoferrin-Interactions and Biological Functions," ed. T.W. ... Antimicrobial peptides of lactoferrin. Adv. Exp. Med. Biol. 357: 209-218.. Wu, H.F., Monroe, D.M., and Church, F.C. 1995. ... Activated lactoferrin (ALF) is a new form of a naturally occurring protein from milk that acts as a powerful deterrent to ... Activated Lactoferrin Exocrine secretions, including milk, deliver LF in a free form, and this molecule interacts with an array ...
Molecules | Free Full-Text | The Lactoferrin Phenomenon—A Miracle Molecule
The function of a protective agent may be played by lactoferrin as a ... Lactoferrin in the Human Diet and Therapy of Diseases. Lactoferrin is an important component in the human diet. Due to its high ... 2. Lactoferrin-Characteristics and Properties. Lactoferrin (LF) is a component of the whey protein of milk of most mammals, ... Lactoferrin, as the name suggests (lacto + ferrin = milk + iron), is iron binding milk protein, which helps to balance iron ...
DSM boosts lactoferrin production
... a US developer of recombinant human lactoferrin, has opened a new manufacturing facility on DSMs fermentation site in Capua, ... Dutch life science company DSM, together with Agennix, a US developer of recombinant human lactoferrin, has opened a new ... developer of recombinant human lactoferrin, has opened a new manufacturing facility on DSMs fermentation site in Capua, Italy ... is dedicated to the commercial production of pharmaceutical grade recombinant human lactoferrin (rhLF). RhLF is a protein found ...
Bovine lactoferrin supplementation for prevention of late-onset
Bovine lactoferrin supplementation prevents late-onset sepsis in very low-birth-weight neonates. ... Substances : Lactoferrin : CK(500) : AC(195). Diseases : Infants: Very Low Birth Weight/Low Birth Weight : CK(212) : AC(19), ... Bovine lactoferrin supplementation prevents late-onset sepsis in very low-birth-weight neonates. - GreenMedInfo Summary ... Bovine lactoferrin supplementation for prevention of late-onset sepsis in very low-birth-weight neonates: a randomized trial. ...
Bovine Lactoferrin Activity Against Chikungunya and Zika Viruses | bioRxiv
Bovine Lactoferrin Activity Against Chikungunya and Zika Viruses. Carlos A. M. Carvalho, Samir M. M. Casseb, Rafael B. ... Bovine Lactoferrin Activity Against Chikungunya and Zika Viruses Message Subject (Your Name) has forwarded a page to you from ... the aim of this work was to evaluate the antiviral potential of bovine lactoferrin (bLf) - an iron-binding glycoprotein with ...
Frontiers | Lactoferrin Against SARS-CoV-2: In Vitro and In Silico Evidences
Lactoferrin (Lf) is a cationic glycoprotein synthetized by exocrine glands and is present in all human secretions. It is also ... Lactoferrin (Lf) is a cationic glycoprotein synthetized by exocrine glands and is present in all human secretions. It is also ... Keywords: lactoferrin, COVID-19, SARS-CoV-2, spike, bovine lactoferrin. Citation: Campione E, Lanna C, Cosio T, Rosa L, Conte ... Lactoferrin Against SARS-CoV-2: In Vitro and In Silico Evidences. Elena Campione1* Caterina Lanna1 Terenzio Cosio1 Luigi Rosa2 ...
Quadruple therapy with lactoferrin for Helicobacter pylori eradication: a randomised, multicentre study
Quadruple therapy with lactoferrin did not significantly increase the H. pylori cure rate of standard 7-day clarithromycin- ... Quadruple therapy with lactoferrin for Helicobacter pylori eradication: a randomised, multicentre study Dig Liver Dis. 2005 Jul ... Recently, lactoferrin administration has been shown to significantly increase the cure rate of 7-day rabeprazole, ... We assessed whether lactoferrin also increases the eradication rate of 7-day esomeprazole, clarithromycin and amoxycillin ...
Growth promotion and cell binding ability of bovine lactoferrin to Bifidobacterium longum
In the present study, in vitro growth promotion and cell binding ability of bovine lactoferrin to several strains of ... Lactoferrin, a major whey protein of human milk, is considered as growth promoter for bifidobacteria, the predominant ... Fluorescence staining showed bovine lactoferrin binding to all tested strains. A lactoferrin-binding protein with a molecular ... Growth promotion and cell binding ability of bovine lactoferrin to Bifidobacterium longum Anaerobe. 2009 Aug;15(4):133-7. doi: ...
Reverse osteoporosis - one of seven reasons why you should learn about lactoferrin - NaturalNews.com
... one of seven reasons why you should learn about lactoferrin ... Lactoferrin Sources. Lactoferrin has its highest content in ... Lactoferrin Benefits. (1) As "first milk" for human and bovine infants, lactoferrin confers increased immunity protection to ... 4) Lactoferrin slows or prevents tumor growth. It modulates cell growth.. (5) Lactoferrin speeds up recovery from diseases, ... 3) Lactoferrin is able to crack the cell walls of bacteria with tough outer cell walls, which are able to evade some ...
Lactoferrin Concentration in the Parotid Saliva of Patients with Chronic Pancreatitis | Digestion | Karger Publishers
Lactoferrin Concentration in the Parotid Saliva of Patients with Chronic Pancreatitis Subject Area: Gastroenterology ... Lactoferrin is present in pancreatic juice, and greatly increased concentrations are found in the pancreatic juice of patients ... Duodenal Lactoferrin in Patients with Chronic Pancreatitis and Gastrointestinal Diseases Digestion (January,2009) ... Plasma Lactoferrin Levels in Patients with Chronic Calcifying Pancreatitis Digestion (January,2009) ...
lactoferrin elisa
Lactoferrin Archives - Infinity Fitness
About Infinity Fitness. Founded by Scott H. Mendelson, Infinity Fitness® is dedicated to the rapid success of our clients worldwide. We provide highly effective supplement protocols which are scientifically engineered by Dr. Eric Serrano, M.D. to amaze. Our 7 day per week expert customer service goes above and beyond to ensure client rapid success.. ...
Alexa Fluor® 594-AffiniPure Rabbit Anti-Human Lactoferrin Antibody | JIR
Specificity: Lactoferrin. Conjugate: Alexa Fluor® 594. Product Category: Whole IgG Affinity-Purified Antibodies. Clonality: ... The antibody may cross-react with lactoferrin from other species. Whole IgG antibodies are isolated as intact molecules from ... Alexa Fluor® 594 AffiniPure Rabbit Anti-Human Lactoferrin. Conjugate Options *Alexa Fluor® 488 ... Based on immunoelectrophoresis and/or ELISA, the antibody reacts with human lactoferrin in human milk. No antibody was detected ...
5 Best Lactoferrin Supplements (2023) Reviewed and Compared
More broadly, lactoferrin may provide immune support.. May Help Prevent Ulcers. A lot of research on lactoferrin has ... Can Lactoferrin Help Fight The Common Cold?. Many studies have investigated whether lactoferrin can help with the prevention ... Do Lactoferrin Supplements Contain Lactose?. While lactoferrin can be sourced from lactose-free sources like rice, it most ... No other products contain lactoferrin-TCR or the synergistic compounds. BioQuad Lactoferrin is also lactose-free (and gluten- ...
The impact of lactoferrin with different levels of metal saturation on the intestinal epithelial barrier function and mucosal...
Lactoferrin that was not bound to its cognate receptor was able to bind and neutralize lipopolysaccharide. Lactoferrin was also ... Table 3 The effect of native lactoferrin (N) on LPS-induced secretion of IL-6 and TNF-α by J774A.1 cells. Full size table. ... Lf lactoferrin, LPS lipopolysaccharide, LfR lactoferrin receptor, TLR4 toll-like receptor 4 ... Lf lactoferrin, LPS lipopolysaccharide, LfR lactoferrin receptor, TLR4 toll-like receptor 4 ...
Lactoferrin, anti-Human Polyclonal Antibod | LeeBio.com
Polyclonal rabbit anti-Human Lactoferrin is available from Lee Biosolutions for IVD manufacturing, life science and research ... Polyclonal Antibody anti-human lactoferrin procedure: Rabbits were immunized with highly purified human lactoferrin. After ... Our Polyclonal Antibody anti-human lactoferrin forms a single precipitation arc against human lactoferrin by ... The anti-human lactoferrin was solid phase absorbed against human serum to ensure specificity. ...
Disulfiram-loaded lactoferrin nanoparticles for treating inflammatory diseases - Ou - Acta Pharmacologica Sinica
Disulfiram-loaded lactoferrin nanoparticles for treating inflammatory diseases ... Disulfiram-loaded lactoferrin nanoparticles for treating inflammatory diseases An-te Ou1,2,3, Jia-xin Zhang1,4, Yue-fei Fang1,5 ... Lactoferrin (LF) is a multifunctional glycoprotein with potent antibacterial and anti-inflammatory activities that acts by ...
Lactoferrin von T William Hutchens kaufen bei Kisch & Co. (9781461525486)
Lactoferrin is an intriguing protein with an interesting structure and several known or suggested biological activiti (EAN: ... Several of the possible physiological functions of lactoferrin are described in detail, including the role of lactoferrin in ... Several of the possible physiological functions of lactoferrin are described in detail, including the role of lactoferrin in ... Lactoferrin is an intriguing protein with an interesting structure and several known or suggested biological activities. We ...
Lactoferrin Reverses Methotrexate Driven Epithelial Barrier Defect by Inhibiting TGF-β Mediated Epithelial to Mesenchymal...
Lactoferrin Reverses Methotrexate Driven Epithelial Barrier Defect by Inhibiting TGF-β Mediated Epithelial to Mesenchymal ... Lactoferrin Reverses Methotrexate Driven Epithelial Barrier Defect by Inhibiting TGF-β Mediated Epithelial to Mesenchymal ... Lactoferrin Reverses Methotrexate Driven Epithelial Barrier Defect by Inhibiting TGF-β Mediated Epithelial to Mesenchymal ... Lactoferrin Reverses Methotrexate Driven Epithelial Barrier Defect by Inhibiting TGF-β Mediated Epithelial to Mesenchymal ...
Medical Science Monitor | Effect of lactoferrin supplementation on the effectiveness and tolerability of a 7-day quadruple...
Lactoferrin, a natural anti-bacterial glycoprotein, seems a promising tool in treating H. Pylori infection, but it has never ... supplementation of bovine lactoferrin (200 mg b.d.). One month after conclusion of therapy, endoscopy was performed in those ... Lactoferrin supplementation was found effective in reducing side-effect incidence. Moreover, it seems capable of achieving a ... Effect of lactoferrin supplementation on the effectiveness and tolerability of a 7-day quadruple therapy after failure of a ...
Anti-LF / LTF / Lactoferrin Antibody | Rabbit anti-Mouse Biotin WB | LSBio
Lactoferrin antibody LS-C300512 is a biotin-conjugated rabbit polyclonal antibody to mouse Lactoferrin (LF / LTF) (aa550-707). ... Lactoferrin antibody LS-C300512 is a biotin-conjugated rabbit polyclonal antibody to mouse Lactoferrin (LF / LTF) (aa550-707). ... LTF , GIG12 , Growth-inhibiting protein 12 , HLF2 , Lactotransferrin , Lactoferrin , LF , Neutrophil lactoferrin , ... Polyclonal Rabbit anti‑Mouse LF / LTF / Lactoferrin Antibody (Biotin, aa550‑707, WB) LS‑C300512 ...
Effects of Dietary Bovine Lactoferrin on Intestinal Lymphocytes of Mice After Dextran Sulfate Sodium or Acute Exercise Challenge
Effects of Dietary Bovine Lactoferrin on Intestinal Lymphocytes of Mice After Dextran Sulfate Sodium or Acute Exercise ... Paul Anthony Spagnuolo (2008). Effects of Dietary Bovine Lactoferrin on Intestinal Lymphocytes of Mice After Dextran Sulfate ... Bovine lactoferrin (bLf) is a dietary whey protein with demonstrated ability to promote anti-inflammatory responses by reducing ...
An evaluation of the expression profiles of salivary proteins lactoferrin and lysozyme and their association with caries...
Lactoferrin was positively correlated with both DMFT and restored teeth. Conclusion: The quantification of lactoferrin and ... Lysozyme, lactoferrin, dental caries, saliva, electrophoresis, polyacrylamide gel Abstract. Purpose: Saliva contains both ... An evaluation of the expression profiles of salivary proteins lactoferrin and lysozyme and their association with caries ... The association between caries experience/activity and the electrophoretic profiles of salivary proteins lactoferrin and ...
The Protective Effects of Lactoferrin Feeding against Endotoxin Lethal Shock in Germfree Piglets . | Institute of Colostrum...
Buy Life Extension - Lactoferrin Caps (Apolactoferrin) - 60 Vegetarian Capsules- VitaCart Offers Discount Lactoferrin Caps ...
Lactoferrin helps to maintain a proper level of good bacteria in the intestinal tract, while controlling the number of bad ... Lactoferrin Caps (Apolactoferrin). 60 Vegetarian Capsules. $49.50. May We Suggest.... Life Extension - L-Arginine/L-Ornithine ... You are Currently Viewing Lactoferrin Caps (Apolactoferrin), 60 Vegetarian Capsules, Life Extension. Look for Similar Products ... Lactoferrin is a milk compound shown to support a strong, healthy immune system response, as well as eye health. ...
Domain closure in lactoferrin. Two hinges produce a see-saw motion between alternative close-packed interfaces.
US Patent for Pichia pastoris strain for producing lactoferrin and methods of use Patent (Patent # 6,423,509 issued July 23,...
The present invention also provides Pichia strains, especially Pichia pastoris KCTC 0500BP, that are resistant to lactoferrin ... The present invention relates to a method of mass-producing lactoferrin polypeptides from yeast which is resistant to ... The origin of the lactoferrin is not limited, and the lactoferrin can be from human, cow, pig or other mammals. ... Also, it is reported that the peptides or polypeptides derived from lactoferrin are superior to lactoferrin itself in ...
GlycoproteinBovine lactoferrinLevels of lactoferrinMilkSupplementationProteinDifferent types of lactoferrinRecombinant human lactoferrinAmount of lactoferrinAbility of lactoferrinAntiviralNeutrophilProduce lactoferrinApolactoferrinFormulasSalivaHumansSecretionsCapsulesColostrumPolyclonal antibodyIntestinalSpecificitySupplementsAntibacterial activityReceptors2023TransferrinPotentExocrineGrowth200mgIngredientsIron absorptionBioactiveSalivaryCapsulePathogensBacterialBindsPolypeptideLactose-freeConcentrationSupplementStrainsProtective EffectsHumanProteinsMoleculeMicrobiomeHelicobacterClinicalInteractsSerumBacteriaMolecularVitroInhibit
Glycoprotein14
- Lactoferrin is a globular glycoprotein with a molecular mass of about 80 kDa that is widely represented in various secretory fluids, such as milk, saliva, tears, and nasal secretions. (wikipedia.org)
- Given the huge burden that Chikungunya and Zika fevers impose to public health in the affected countries and the lack of effective interventions against them, the aim of this work was to evaluate the antiviral potential of bovine lactoferrin (bLf) - an iron-binding glycoprotein with broad-spectrum antimicrobial properties - in both CHIKV and ZIKV infections. (biorxiv.org)
- Lactoferrin (Lf) is a cationic glycoprotein synthetized by exocrine glands and is present in all human secretions. (frontiersin.org)
- Lactoferrin is a protein, a glycoprotein specifically, from mammalian milk. (romanfitnesssystems.com)
- Lactoferrin (Lf) is an 80-kDa glycoprotein that belongs to the transferrin family and is abundant in the colostrum and milk of mammals. (springer.com)
- Lactoferrin (LF) is a multifunctional glycoprotein with potent antibacterial and anti-inflammatory activities that acts by neutralizing circulating endotoxins and activating cellular responses. (chinaphar.com)
- Lactoferrin is a glycoprotein that has physiological and biological characteristics such as bactericidal, growth stimulatory, iron carrying activity, immune modulation, and specific reaction to membrane receptors. (justia.com)
- Lactoferrin is a cytokine glycoprotein, which inhibits as well as prevents growth of bacteria, fungi, virus, and parasites. (hexaresearch.com)
- Lactoferrin is a glycoprotein (combination of carbohydrate and protein) that has been shown in clinical research to be effective in protecting the body from viruses that cause everything from the common cold and influenza, hepatitis B and C, and polio to some of the infections caused by the family of corona viruses. (milkandhoneyhealthfoods.com)
- Lactoferrin (Lf) is an iron-binding milk glycoprotein that promotes the growth of selected probiotic strains. (encyclopedia.pub)
- Bovine and human milk contains a wide array of bioactive components, including the iron-binding glycoprotein known as lactoferrin (Lf). (encyclopedia.pub)
- Lactoferrin is a 703-amino acid glycoprotein originally isolated from milk. (scienzaonline.com)
- Lactoferrin is an iron-binding glycoprotein found in human and bovine milk. (aordistribution.co.uk)
- Lactoferrin is an iron chelating glycoprotein involved in numerous biological mechanisms, present in breast milk and in numerous organic secretions: saliva, tears, nasal and vaginal secretions. (apolact.com)
Bovine lactoferrin8
- WOODLAND, Calif. and SINGAPORE , Aug. 17, 2022 /PRNewswire/ -- Following 18 months of extensive R&D, TurtleTree has officially announced its production of LF+, the world's first sustainable bovine lactoferrin created using precision fermentation technology. (prnewswire.com)
- Bovine lactoferrin supplementation prevents late-onset sepsis in very low-birth-weight neonates. (greenmedinfo.com)
- Bovine lactoferrin supplementation for prevention of late-onset sepsis in very low-birth-weight neonates: a randomized trial. (greenmedinfo.com)
- In the present study, in vitro growth promotion and cell binding ability of bovine lactoferrin to several strains of Bifidobacterium longum have been demonstrated. (nih.gov)
- Cell binding ability of lactoferrin was inspected under an inverted confocal laser scanning microscope by incubation bacterial cells with biotinylated bovine lactoferrin and FITC-conjugated avidin. (nih.gov)
- Fluorescence staining showed bovine lactoferrin binding to all tested strains. (nih.gov)
- Bovine lactoferrin (bLf) is a dietary whey protein with demonstrated ability to promote anti-inflammatory responses by reducing pro-inflammatory or increasing anti-inflammatory cytokine concentrations within the intestine. (uwaterloo.ca)
- With Bovine Lactoferrin and L-Glutamine. (oskiaskincare.com)
Levels of lactoferrin5
- It is not known whether these high levels of lactoferrin represent a genetically determined defect predisposing to the later development of chronic pancreatitis or are simply a consequence of the disease. (karger.com)
- The LACTOFERRIN EZ VUE® is an immunochromatographic test for the qualitative detection of elevated levels of lactoferrin, a marker for fecal leukocytes and an indicator of intestinal inflammation. (hylabs.co.il)
- The Fecal Lactoferrin test detects elevated levels of lactoferrin released from fecal leukocytes as a marker of intestinal inflammation. (peacehealthlabs.org)
- This test is not valid for infants who are breast feeding or mixed feeding as breast milk contains high levels of lactoferrin and will give a false positive result. (peacehealthlabs.org)
- Individuals with specific granule deficiency express normal levels of lactoferrin and transcobalamin in their saliva but not in either their plasma or neutrophils. (lu.se)
Milk32
- Lactoferrin can be purified from milk or produced recombinantly. (wikipedia.org)
- Therefore, it was named lactoferrin in 1961, though the name lactotransferrin was used in some earlier publications, and later studies demonstrated that the protein is not restricted to milk. (wikipedia.org)
- Concentration of lactoferrin in the milk varies from 7 g/L in the colostrum to 1 g/L in mature milk. (wikipedia.org)
- Elaborating on the value that lactoferrin can bring to consumer nutrition, TurtleTree's Chief Scientific Officer, Aletta Schnitzler , explained: "Lactoferrin is one of the key ingredients that gives human milk its uniquely beneficial properties. (prnewswire.com)
- Activated lactoferrin (ALF) is a new form of a naturally occurring protein from milk that acts as a powerful deterrent to pathogenic bacteria that may be present on a meat surface. (ift.org)
- Lactoferrin, a major whey protein of human milk, is considered as growth promoter for bifidobacteria, the predominant microorganisms of human intestine. (nih.gov)
- Lactoferrin has its highest content in mother's first milk from human breast feeding or colostrum (first milk) from cows. (naturalnews.com)
- Lactoferrin remains in cow's milk after the baby calf's early nursing period, but in lower concentrations. (naturalnews.com)
- Lactoferrin supplements are even approved by the same FDA that attacks raw milk production and sales. (naturalnews.com)
- So if obtaining colostrum or raw milk is prohibitive for financial or legal reasons, you can order lactoferrin contained in capsules from your favorite online supplement source, where better prices are available. (naturalnews.com)
- 1) As "first milk" for human and bovine infants, lactoferrin confers increased immunity protection to support their not fully developed immune systems. (naturalnews.com)
- And if you're not in a raw milk loop, or if the FDA and USDA get their way eventually, at least we all know there is one option left: Lactoferrin supplements. (naturalnews.com)
- Based on immunoelectrophoresis and/or ELISA, the antibody reacts with human lactoferrin in human milk. (jacksonimmuno.com)
- Most lactoferrin products come from cow's milk. (romanfitnesssystems.com)
- The results of recently conducted clinical trials suggest that lactoferrin, an iron-binding protein that is abundant in mammalian colostrum and milk, may be an effective agent in preventing sepsis in newborns. (springer.com)
- Lactoferrin is a milk compound shown to support a strong, healthy immune system response, as well as eye health. (vitacart.com)
- Lactoferrin polypeptides have been isolated mainly from milk serum. (justia.com)
- Lactoferrin is used in infant formula as a means to imitate human milk. (hexaresearch.com)
- The most important raw material required for lactoferrin manufacturing is animal milk usually procured from local cattle breeders. (hexaresearch.com)
- The lactoferrin found in colostrum has been found to be at seven times the amount that is present later on in the breast milk. (milkandhoneyhealthfoods.com)
- Breast milk lactoferrin is instrumental in protecting the newborn from infectious disease while their immune system is in development. (milkandhoneyhealthfoods.com)
- While lactoferrin is basically an iron binding milk protein (lacto means milk and ferrin means iron), there are 29 different types of lactoferrin all having different functions, many of which are connected with immunity and especially immunity against viruses. (milkandhoneyhealthfoods.com)
- At Milk 'N Honey we carry a lactoferrin product from the company Life Extension. (milkandhoneyhealthfoods.com)
- Lactoferrin is for the most part separated from cow-like milk and thus added and blended into different business food items for example in beauty care products, baby equation, toothpaste, and nourishing enhancements. (snsinsider.com)
- Lactoferrin can be gotten from various sources including rice flour, human milk, and creature milk. (snsinsider.com)
- Colostrum contains multiple times more lactoferrin than the milk created a while later. (snsinsider.com)
- A natural food supplement combining Lactoferrin (from cow milk) and L-Glutamine designed to support the natural immune system, gut microbiome, oral and skin health. (oskiaskincare.com)
- healthy gut = healthy skin) Lactoferrin could be described as the 'ideal probiotic' and is considered the fire-starter of our gut microbiome when it is first introduced to infants in milk colostrum soon after birth. (oskiaskincare.com)
- Lactoferrin-250 is an iron transporter protein sourced from bovine milk. (aordistribution.co.uk)
- Lactoferrin is a protein extracted from cow's milk and therefore the use of the product is not recommended in case of allergy to milk proteins. (apolact.com)
- Derived from fresh Australian cow's milk, our lactoferrin is a fine spray-dried powder with over 95% purity. (lactoferrin.co)
- we know that breast milk includes a lot of very important microbes, probiotics, immune complexes - like lactoferrin - and immunoglobulins. (leapfrogremedies.com)
Supplementation3
- A 2014 review study in the Journal of Infection and Chemotherapy examined all of the available research on lactoferrin and concluded that lactoferrin, even through oral supplementation, may protect against viral infections. (romanfitnesssystems.com)
- Therefore, we hypothesize that lactoferrin supplementation is a relevant strategy for preventing sepsis. (springer.com)
- Leapfrog founder Stephanie Drax interviewed Kiran to find out more about gut issues, how to improve our microbiome and how Lactoferrin supplementation can be a powerful tool for our overall health. (leapfrogremedies.com)
Protein14
- Lactoferrin (LF), also known as lactotransferrin (LTF), is a multifunctional protein of the transferrin family. (wikipedia.org)
- Similarity in the size of exons and their distribution in the domains of the protein molecule indicates that the evolutionary development of lactoferrin gene occurred by duplication. (wikipedia.org)
- The degree of glycosylation of the protein may be different and therefore the molecular weight of lactoferrin varies between 76 and 80 kDa. (wikipedia.org)
- In pioneering the use of this technology for lactoferrin and its inclusion in food, TurtleTree is uniquely poised to be a frontrunner in the highly sought-after functional protein market. (prnewswire.com)
- A lactoferrin-binding protein with a molecular weight of approximately 67 kDa was also detected in the extracted membrane and cytosolic fraction of each B. longum strain by far-Western blot technique using biotinylated lactoferrin and horseradish peroxidase-conjugated streptavidin. (nih.gov)
- Based on these results, we suggest that existence of lactoferrin-binding protein could be a common characteristic in bifidobacteria. (nih.gov)
- It can also be hypothesized that lactoferrin-binding protein in bifidobacteria is not only involved in growth stimulation mechanism but also could play different roles. (nih.gov)
- However, despite numerous basic studies on lactoferrin, very little is known about how metal saturation of this protein affects a host's health. (springer.com)
- Lactoferrin is an intriguing protein with an interesting structure and several known or suggested biological activities. (kisch-online.de)
- Qianwa reported that 1.5˜2.0 mg/l of recombinant human lactoferrin was obtained by expressing it in the form of a fusion protein between a yeast invertase and human lactoferrin by using a chelatin promoter in Saccharomyces cerevisiae (Qianwa Liang et.al. (justia.com)
- No. 5,571,697, antibacterial polypeptide derived from lactoferrin was expressed as a fusion protein in Aspergillus. (justia.com)
- Since the microorganism of the present invention is extremely resistant against lactoferrin polypeptide, the lactoferrin polypeptide can be produced as a fusion protein or a peptide itself by the microorganism of the present invention. (justia.com)
- These practical capacities of the lactoferrin rely on the construction of the multifunctional protein. (snsinsider.com)
- Lactoferrin is a piece of the bigger transferrin protein family and has great iron-restricting properties. (snsinsider.com)
Different types of lactoferrin1
- This variation may indicate functional differences between different types of lactoferrin. (wikipedia.org)
Recombinant human lactoferrin2
- Dutch life science company DSM, together with Agennix, a US developer of recombinant human lactoferrin, has opened a new manufacturing facility on DSM's fermentation site in Capua, Italy. (dairyreporter.com)
- The facility, located just north of Naples, is dedicated to the commercial production of pharmaceutical grade recombinant human lactoferrin (rhLF). (dairyreporter.com)
Amount of lactoferrin2
- Each capsule comes with 30 capsules, and contains 60mg of lactoferrin, which is the amount of lactoferrin a healthy person innately produces and uses on a daily basis (i.e. daily body turnover), per their research. (romanfitnesssystems.com)
- In a study recently posted in the Journal of Microbiology, Immunology and Infection, a randomized, double-blinded, placebo-controlled trial was done in Japan where an intake of either placebo or a 200 mg or 600 mg amount of lactoferrin was administrated for 12 weeks to healthy adults in Kyushu University of Health and Welfare. (milkandhoneyhealthfoods.com)
Ability of lactoferrin1
- Received 10 November 1997/Returned for modification 22 December 1997/Accepted 15 January 1998 The unique germfree, colostrum-deprived, immunologically "virgin" piglet model was used to evaluate the ability of lactoferrin (LF) to protect against lethal shock induced by intravenously administered endotoxin. (colostrumresearch.org)
Antiviral3
- 2) Concentrated enough in one's blood, lactoferrin is antiviral, antibacterial (to only the bad bacteria), and anti-fungal. (naturalnews.com)
- In a 2014 review of lactoferrin research published in the Journal of Infection and Chemotherapy, it was stated that many studies have shown the in vitro (research done in a lab) antiviral activity of lactoferrin against viral pathogens that cause common infections such as the common cold, influenza, gastroenteritis, summer cold, and herpes. (milkandhoneyhealthfoods.com)
- Numerous scientific literature reports that Lactoferrin has multiple beneficial effects including: antimicrobial, immunostimulating, anti-inflammatory, antiviral, rebalancing the iron-dependent enzymatic systems. (apolact.com)
Neutrophil2
- Plasma lactoferrin is predominantly neutrophil derived but indications are that it may also be produced by other cells. (scienzaonline.com)
- Role of neutrophil extracellular la NETosis en las enfermedades infecciosas pulmonares. (bvsalud.org)
Produce lactoferrin3
- Schnitzler continues: "To be able to bring these benefits to the public in a meaningful way, we need to be able to produce lactoferrin both sustainably and at commercial volume. (prnewswire.com)
- The present invention provides a method to mass-produce lactoferrin polypeptide from microorganisms. (justia.com)
- We produce lactoferrin tailored to your specifications, maintaining the highest quality standards. (lactoferrin.co)
Apolactoferrin4
- However, the various lactoferrin forms did effectively inhibit the pro-inflammatory response in macrophages that were activated with lipopolysaccharide with the most potent effect observed for apolactoferrin. (springer.com)
- The product image of Life Extension - Lactoferrin Caps (Apolactoferrin) - 60 Vegetarian Capsules shown on this page may differ from actual size and flavor, or due to packaging update. (vitacart.com)
- Apolact TDC is a dietary supplement based on Apolactoferrin in liposomes, useful in case of increased need and / or deficiency of lactoferrin. (apolact.com)
- Apolactoferrin (iron-free form of lactoferrin) is 5 times more active than lactoferrin itself. (apolact.com)
Formulas1
- Therefore, lactoferrin polypeptide is a good additive for infant formulas and animal feed or drugs due to its bacteriostatic, cell growth stimulatory or inflammation inhibitory effects. (justia.com)
Saliva1
- In view of the morphological and functional similarities between the pancreatic and parotid glands, we have measured the immunoreactive lactoferrin concentration in pure parotid saliva of 30 patients with chronic calcific pancreatitis, 26 controls, 5 patients with proven pancreatic cancer, 2 patients with Sjögren's disease and 2 patients with chronic recurrent parotitis. (karger.com)
Humans1
- In humans, lactoferrin gene LTF is located on the third chromosome in the locus 3q21-q23. (wikipedia.org)
Secretions1
- Lactoferrin is one of the transferrin proteins that transfer iron to the cells and control the level of free iron in the blood and external secretions. (wikipedia.org)
Capsules1
- This product contains 60 capsules of lactoferrin at 300 mgs each. (milkandhoneyhealthfoods.com)
Colostrum1
- Lactoferrin is found in abundance in colostrum. (milkandhoneyhealthfoods.com)
Polyclonal antibody4
- Polyclonal Antibody anti-human lactoferrin procedure: Rabbits were immunized with highly purified human lactoferrin. (leebio.com)
- Our Polyclonal Antibody anti-human lactoferrin forms a single precipitation arc against human lactoferrin by immunoelectrophoresis. (leebio.com)
- BULK quantities from 5,000 mg of single lot sizes of Polyclonal Antibody anti-human lactoferrin. (leebio.com)
- Lactoferrin antibody LS-C300512 is a biotin-conjugated rabbit polyclonal antibody to mouse Lactoferrin (LF / LTF) (aa550-707). (lsbio.com)
Intestinal1
- Therefore, the main objective of this study was to elucidate how iron-depleted, iron-saturated, and manganese-saturated forms of lactoferrin regulate intestinal barrier function via interactions with epithelial cells and macrophages. (springer.com)
Specificity1
- The anti-human lactoferrin was solid phase absorbed against human serum to ensure specificity. (leebio.com)
Supplements5
- Lactoferrin supplements reduce the risk of respiratory tract infections, based on a recent meta-analysis of randomized controlled trials. (wikipedia.org)
- What Are the Benefits of Taking Lactoferrin Supplements? (romanfitnesssystems.com)
- In a 2017 study , lactoferrin supplements combined with zinc and vitamin E even improved acne, across over 160 subjects aged 13-40. (romanfitnesssystems.com)
- So, here are the highest-quality lactoferrin supplements on the market. (romanfitnesssystems.com)
- He has a special interest in probiotics and prebiotics to modulate the immune system and believes that Lactoferrin - a hero ingredient of Leapfrog Remedies' supplements - has a vital part to play in achieving optimum gut health, including its superpower in binding microplastics. (leapfrogremedies.com)
Antibacterial activity3
- Lactoferrin provides antibacterial activity to human infants. (wikipedia.org)
- Lactoferrin is known to have immuno-stimulatory effect and antibacterial activity. (justia.com)
- Also, it is reported that the peptides or polypeptides derived from lactoferrin are superior to lactoferrin itself in antibacterial activity and stability (U.S. Pat. (justia.com)
Receptors1
- M catarrhalis also expresses specific proteins for iron uptake that act as receptors for transferrin and lactoferrin. (medscape.com)
20232
- Lactoferrin Market Size was esteemed at USD 232.17 million out of 2022 and is supposed to arrive at USD 459.23 million by 2030, and develop at a CAGR of 8.9% over the forecast period 2023-2030. (snsinsider.com)
- Lactoferrin" Encyclopedia , https://encyclopedia.pub/entry/15569 (accessed December 04, 2023). (encyclopedia.pub)
Transferrin2
- Exons of the lactoferrin gene in oxen have a similar size to the exons of other genes of the transferrin family, whereas the sizes of introns differ within the family. (wikipedia.org)
- Lactoferrin is a trendy answer for sickliness and is generally perceived to be essential for the transferrin family, which manages the degrees of free iron in body liquid alongside expanding the degrees of hemoglobin by improving the capacity to tie iron. (snsinsider.com)
Potent1
- BACKGROUND: Because the human lactoferrin-derived peptide, hLF(1-11), exerts potent in vitro candidacidal activity, we investigated whether it displays antifungal activity against disseminated Candida albicans infections. (wellnessresourcesnews.com)
Exocrine1
- These findings suggest that increased lactoferrin secretion is confined to the exocrine pancreas in patients with chronic pancreatitis and is thus probably a phenomenon secondary to the disease. (karger.com)
Growth8
- A dose-dependent as well as strain-dependent growth promotion effect by lactoferrin was observed. (nih.gov)
- 4) Lactoferrin slows or prevents tumor growth. (naturalnews.com)
- Several of the possible physiological functions of lactoferrin are described in detail, including the role of lactoferrin in bacterial killing, its involvement in growth and proliferation, in immune function and in iron absorption. (kisch-online.de)
- In the case of producing lactoferrin or its antibacterial peptide derivatives by using genetic engineering techniques, expressed lactoferrin or antibacterial peptide could slow down the growth of or even kill the host microorganism. (justia.com)
- Also the microorganism of the present invention can be used in mass-producing not only lactoferrin polypeptide but also other antibacterial peptides that are difficult to mass-produce due to its activity to slow down the growth of or to kill the host cells. (justia.com)
- The global lactoferrin market size was valued at USD 87.8 million in 2017 and is expected to witness further growth over the forecast period. (hexaresearch.com)
- This factor is of utmost importance in terms of infant nutrition as their bodies require lactoferrin for healthy growth and systematic bodily functions. (hexaresearch.com)
- Studies have shown that lactoferrin increased the growth rate (40-200%) of beneficial bacteria (such as Bifidobacterium bifidum, B. longum, B. lactis, B. infantis, Lactobacillus reuteri, L. rhamnosus and L. coryniformis). (oskiaskincare.com)
200mg1
- Overall, 133 consecutive patients with non-ulcer dyspepsia and H. pylori infection were randomised to receive either a standard 7-day triple therapy with esomeprazole 20mg b.i.d., clarithromycin 500 mg b.i.d. and amoxycillin 1g b.i.d. (68 patients) or a quadruple therapy comprising of the same regimen plus lactoferrin 200mg b.i.d. (65 patients). (nih.gov)
Ingredients1
- But one of its most magical ingredients, lactoferrin , is now available in FDA approved supplement form. (naturalnews.com)
Iron absorption2
- Lactoferrin has even been studied for improving iron absorption . (romanfitnesssystems.com)
- Lactoferrin is known to have capabilities of iron absorption, which helps bind the free radicals of iron. (hexaresearch.com)
Bioactive1
- Since their product is the most bioactive and bioavailable, their calibrated lactoferrin dose delivers the ideal health benefits for $35 (whereas other products require higher lactoferrin doses to be effective. (romanfitnesssystems.com)
Salivary2
- The association between caries experience/activity and the electrophoretic profiles of salivary proteins lactoferrin and lysozyme was evaluated. (pucrs.br)
- Objective: This study compared the concentration of salivary lactoferrin in patients with and without chronic periodontitis and investigated correlations with clinical variables of the disease. (bvsalud.org)
Capsule2
- BioQuad Lactoferrin Gold 1.8® is available in 30 and 60 capsule packages, for $35 and $60 respectively. (romanfitnesssystems.com)
- rice starch, Apo-lactoferrin in powdered liposomes, capsule in vegetable gelatin, anticaking agent: silicon dioxide. (apolact.com)
Pathogens2
- Lactoferrin is found in all the mucus membranes of the body and plays an important role in preventing pathogens from entering the body through the linings of the oral and nasal passageways, digestive system and all tissues having mucus membranes. (milkandhoneyhealthfoods.com)
- Lactoferrin has also been shown to activate areas of the immune system such as increasing the production of natural killer cells which play a vital role in identifying pathogens and eliminating them. (milkandhoneyhealthfoods.com)
Bacterial1
- Iron regulation causing anti-bacterial and anti-oxidant activity) Lactoferrin binds, releases, transports and regulates the absorption of iron, taking it to where it's required within the body and helping prevent excess build up and successfully treats iron-deficiency in pregnancy. (oskiaskincare.com)
Binds1
- On a mechanistic level, lactoferrin binds with and transports iron, which is a crucial mineral for hundreds of bodily functions. (romanfitnesssystems.com)
Polypeptide7
- X-ray diffraction reveals that lactoferrin is based on one polypeptide chain that contains about 700 amino acids and forms two homologous globular domains named N-and C-lobes. (wikipedia.org)
- The present invention provides a novel germ strain, which is resistant against lactoferrin polypeptide. (justia.com)
- The present invention provides a germ strain that produces lactoferrin polypeptide. (justia.com)
- FIG. 1 is a photograph showing the resistance of microorganisms against lactoferrin polypeptide of the present invention. (justia.com)
- FIGS. 4A˜4F are photographs showing the resistance of the transformant by expressing Korean cow lactoferrin polypeptide of the present invention against lactoferrin polypeptide. (justia.com)
- The present inventors have explored lactoferrin polypeptide resistant germ strains from samples of soybean sauce, soybean paste and wine obtained from Choongchung province, Korea. (justia.com)
- The inventors also screened and identified superior lactoferrin polypeptide resistant strains. (justia.com)
Lactose-free2
- BioQuad Lactoferrin is also lactose-free (and gluten-free, and non-GMO). (romanfitnesssystems.com)
- AOR Lactoferrin is from a dairy source but is lactose free with little to no casein. (aordistribution.co.uk)
Concentration1
- No difference in the lactoferrin concentration was detected between control subjects and patients with chronic pancreatitis or pancreatic cancer. (karger.com)
Supplement1
- it may be prudent to add a lactoferrin supplement to your diet. (milkandhoneyhealthfoods.com)
Strains1
- The present invention also provides Pichia strains, especially Pichia pastoris KCTC 0500BP, that are resistant to lactoferrin polypeptides. (justia.com)
Protective Effects1
- This article went on to explain that an increasing number of recent studies done in vivo (research done with a living organism) have shown protective effects of lactoferrin by oral administration against common viral infections. (milkandhoneyhealthfoods.com)
Human5
- In a 2022 review, researchers from Poland highlighted a fascinating function of lactoferrin as a guardian of the human genome, capable of modulating cell cycle activity and DNA repair. (prnewswire.com)
- The structure of human lactoferrin is composed of 681 amino acid residues. (justia.com)
- The origin of the lactoferrin is not limited, and the lactoferrin can be from human, cow, pig or other mammals. (justia.com)
- Because of this, lactoferrin offers antibacterial and antifungal capacity to human babies. (snsinsider.com)
- Human lactoferrin-derived peptide's antifungal activities against disseminated Candida albicans infection. (wellnessresourcesnews.com)
Proteins3
- Lactoferrin belongs to the basic proteins, its isoelectric point is 8.7. (wikipedia.org)
- There was also no change in the production of tight junction proteins regardless of lactoferrin metal saturation status. (springer.com)
- Lactoferrin stimulates the production of interferons which are a group of proteins that the body produces to directly confront virus to destroy them. (milkandhoneyhealthfoods.com)
Molecule1
- One test measures a molecule called lactoferrin. (medlineplus.gov)
Microbiome1
- Studies have shown that Lactoferrin can help reduce both acne lesion severity and count as well as associated inflammation, in addition to supporting the gut microbiome which additionally positively supports skin health and condition. (oskiaskincare.com)
Helicobacter1
- There has been a conflict of interest pertaining to the effectiveness of lactoferrin in treating diseases such as Helicobacter pylori (H. pylori) infection. (hexaresearch.com)
Clinical1
- The interest is expected to become attributable to the expansion in the number of clinical examinations supporting baby equation reconciliation with lactoferrin and changing purchaser elements towards newborn child beneficial food sources. (snsinsider.com)
Interacts2
- Lactoferrin interacts with DNA and RNA, polysaccharides and heparin, and shows some of its biological functions in complexes with these ligands. (wikipedia.org)
- A lot of research on lactoferrin has specifically looked at how it interacts with the bacteria h.pylori , the bacteria responsible for stomach ulcers. (romanfitnesssystems.com)
Serum1
- Lactoferrin has been a pivotal answer for frailty, its elevated degree of bioavailability alongside the capacity to increment serum ferritin levels by multiple times permits effective retention of iron when contrasted with other iron sources. (snsinsider.com)
Bacteria1
- 3) Lactoferrin is able to crack the cell walls of bacteria with tough outer cell walls, which are able to evade some antibiotics. (naturalnews.com)
Molecular1
- Aspects of the molecular biology of lactoferrin and its specific interactions with different cell types are also included. (kisch-online.de)
Vitro1
- Numerous in-vitro tests have to be carried out to test effectiveness of lactoferrin when validating the claims made regarding a lactoferrin-induced product. (hexaresearch.com)
Inhibit1
- In this research, lactoferrin was seen to inhibit viral attachment to the target cells. (milkandhoneyhealthfoods.com)
