Cattle Diseases: Diseases of domestic cattle of the genus Bos. It includes diseases of cows, yaks, and zebus.Bifidobacterium: A rod-shaped, gram-positive, non-acid-fast, non-spore-forming, non-motile bacterium that is a genus of the family Bifidobacteriaceae, order Bifidobacteriales, class ACTINOBACTERIA. It inhabits the intestines and feces of humans as well as the human vagina.Cattle: Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor.Intestines: The section of the alimentary canal from the STOMACH to the ANAL CANAL. It includes the LARGE INTESTINE and SMALL INTESTINE.Swine: Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).Diarrhea: An increased liquidity or decreased consistency of FECES, such as running stool. Fecal consistency is related to the ratio of water-holding capacity of insoluble solids to total water, rather than the amount of water present. Diarrhea is not hyperdefecation or increased fecal weight.Animal Feed: Foodstuff used especially for domestic and laboratory animals, or livestock.Coprophagia: Eating of excrement by animal species.Colony Count, Microbial: Enumeration by direct count of viable, isolated bacterial, archaeal, or fungal CELLS or SPORES capable of growth on solid CULTURE MEDIA. The method is used routinely by environmental microbiologists for quantifying organisms in AIR; FOOD; and WATER; by clinicians for measuring patients' microbial load; and in antimicrobial drug testing.Germ-Free Life: Animals not contaminated by or associated with any foreign organisms.Intestine, Large: A segment of the LOWER GASTROINTESTINAL TRACT that includes the CECUM; the COLON; and the RECTUM.RNA, Ribosomal, 16S: Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.DNA, Bacterial: Deoxyribonucleic acid that makes up the genetic material of bacteria.Bile: An emulsifying agent produced in the LIVER and secreted into the DUODENUM. Its composition includes BILE ACIDS AND SALTS; CHOLESTEROL; and ELECTROLYTES. It aids DIGESTION of fats in the duodenum.Polymerase Chain Reaction: In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.Bacteroides: A genus of gram-negative, anaerobic, rod-shaped bacteria. Its organisms are normal inhabitants of the oral, respiratory, intestinal, and urogenital cavities of humans, animals, and insects. Some species may be pathogenic.Digestion: The process of breakdown of food for metabolism and use by the body.Campylobacter: A genus of bacteria found in the reproductive organs, intestinal tract, and oral cavity of animals and man. Some species are pathogenic.Lactobacillus: A genus of gram-positive, microaerophilic, rod-shaped bacteria occurring widely in nature. Its species are also part of the many normal flora of the mouth, intestinal tract, and vagina of many mammals, including humans. Pathogenicity from this genus is rare.Digestive System: A group of organs stretching from the MOUTH to the ANUS, serving to breakdown foods, assimilate nutrients, and eliminate waste. In humans, the digestive system includes the GASTROINTESTINAL TRACT and the accessory glands (LIVER; BILIARY TRACT; PANCREAS).Cecum: The blind sac or outpouching area of the LARGE INTESTINE that is below the entrance of the SMALL INTESTINE. It has a worm-like extension, the vermiform APPENDIX.Biotransformation: The chemical alteration of an exogenous substance by or in a biological system. The alteration may inactivate the compound or it may result in the production of an active metabolite of an inactive parent compound. The alterations may be divided into METABOLIC DETOXICATION, PHASE I and METABOLIC DETOXICATION, PHASE II.Bacterial Shedding: The expelling of bacteria from the body. Important routes include the respiratory tract, genital tract, and intestinal tract.Swine Diseases: Diseases of domestic swine and of the wild boar of the genus Sus.Administration, Oral: The giving of drugs, chemicals, or other substances by mouth.Eubacterium: A genus of gram-positive, rod-shaped bacteria found in cavities of man and animals, animal and plant products, infections of soft tissue, and soil. Some species may be pathogenic. No endospores are produced. The genus Eubacterium should not be confused with EUBACTERIA, one of the three domains of life.Escherichia coli O157: A verocytotoxin-producing serogroup belonging to the O subfamily of Escherichia coli which has been shown to cause severe food-borne disease. A strain from this serogroup, serotype H7, which produces SHIGA TOXINS, has been linked to human disease outbreaks resulting from contamination of foods by E. coli O157 from bovine origin.Fatty Acids, Volatile: Short-chain fatty acids of up to six carbon atoms in length. They are the major end products of microbial fermentation in the ruminant digestive tract and have also been implicated in the causation of neurological diseases in humans.Giardia: A genus of flagellate intestinal EUKARYOTES parasitic in various vertebrates, including humans. Characteristics include the presence of four pairs of flagella arising from a complicated system of axonemes and cysts that are ellipsoidal to ovoidal in shape.Escherichia coli Infections: Infections with bacteria of the species ESCHERICHIA COLI.Fermentation: Anaerobic degradation of GLUCOSE or other organic nutrients to gain energy in the form of ATP. End products vary depending on organisms, substrates, and enzymatic pathways. Common fermentation products include ETHANOL and LACTIC ACID.Cryptosporidiosis: Intestinal infection with organisms of the genus CRYPTOSPORIDIUM. It occurs in both animals and humans. Symptoms include severe DIARRHEA.Giardiasis: An infection of the SMALL INTESTINE caused by the flagellated protozoan GIARDIA LAMBLIA. It is spread via contaminated food and water and by direct person-to-person contact.Salmonella: A genus of gram-negative, facultatively anaerobic, rod-shaped bacteria that utilizes citrate as a sole carbon source. It is pathogenic for humans, causing enteric fevers, gastroenteritis, and bacteremia. Food poisoning is the most common clinical manifestation. Organisms within this genus are separated on the basis of antigenic characteristics, sugar fermentation patterns, and bacteriophage susceptibility.Clostridium: A genus of motile or nonmotile gram-positive bacteria of the family Clostridiaceae. Many species have been identified with some being pathogenic. They occur in water, soil, and in the intestinal tract of humans and lower animals.Gastrointestinal Contents: The contents included in all or any segment of the GASTROINTESTINAL TRACT.DNA, Ribosomal: DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.Bacteria: One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.Isospora: A genus of protozoan parasites found in the intestines of birds, amphibians, reptiles, and mammals, including man. The oocysts produce two sporocysts, each with four sporozoites. Many species are parasitic in wild and domestic animals.Diet: Regular course of eating and drinking adopted by a person or animal.Cryptosporidium: A genus of coccidian parasites of the family CRYPTOSPORIDIIDAE, found in the intestinal epithelium of many vertebrates including humans.Desulfovibrionaceae Infections: Infections with bacteria of the family Desulfovibrionaceae.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Horses: Large, hoofed mammals of the family EQUIDAE. Horses are active day and night with most of the day spent seeking and consuming food. Feeding peaks occur in the early morning and late afternoon, and there are several daily periods of rest.Intestinal Absorption: Uptake of substances through the lining of the INTESTINES.Bifidobacteriales Infections: Infections with BACTERIA of the order Bifidobacteriales. This includes infections in the genera BIFIDOBACTERIUM and GARDNERELLA, in the family Bifidobacteriaceae.Species Specificity: The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.Gastrointestinal Tract: Generally refers to the digestive structures stretching from the MOUTH to ANUS, but does not include the accessory glandular organs (LIVER; BILIARY TRACT; PANCREAS).Salmonella Infections, Animal: Infections in animals with bacteria of the genus SALMONELLA.Spirochaetales Infections: Infections with bacteria of the order SPIROCHAETALES.Colon: The segment of LARGE INTESTINE between the CECUM and the RECTUM. It includes the ASCENDING COLON; the TRANSVERSE COLON; the DESCENDING COLON; and the SIGMOID COLON.Sequence Analysis, DNA: A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.Abattoirs: Places where animals are slaughtered and dressed for market.Lawsonia Bacteria: A genus of gram-negative, obligate intracellular bacteria causing a proliferative enteritis in animals, especially pigs, deer, horses, and rabbits.Carbon Radioisotopes: Unstable isotopes of carbon that decay or disintegrate emitting radiation. C atoms with atomic weights 10, 11, and 14-16 are radioactive carbon isotopes.Culture Media: Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.Dietary Fiber: The remnants of plant cell walls that are resistant to digestion by the alimentary enzymes of man. It comprises various polysaccharides and lignins.Bile Acids and Salts: Steroid acids and salts. The primary bile acids are derived from cholesterol in the liver and usually conjugated with glycine or taurine. The secondary bile acids are further modified by bacteria in the intestine. They play an important role in the digestion and absorption of fat. They have also been used pharmacologically, especially in the treatment of gallstones.Water Pollution: Contamination of bodies of water (such as LAKES; RIVERS; SEAS; and GROUNDWATER.)Nitrogen: An element with the atomic symbol N, atomic number 7, and atomic weight [14.00643; 14.00728]. Nitrogen exists as a diatomic gas and makes up about 78% of the earth's atmosphere by volume. It is a constituent of proteins and nucleic acids and found in all living cells.Dogs: The domestic dog, Canis familiaris, comprising about 400 breeds, of the carnivore family CANIDAE. They are worldwide in distribution and live in association with people. (Walker's Mammals of the World, 5th ed, p1065)Tissue Distribution: Accumulation of a drug or chemical substance in various organs (including those not relevant to its pharmacologic or therapeutic action). This distribution depends on the blood flow or perfusion rate of the organ, the ability of the drug to penetrate organ membranes, tissue specificity, protein binding. The distribution is usually expressed as tissue to plasma ratios.Disease Reservoirs: Animate or inanimate sources which normally harbor disease-causing organisms and thus serve as potential sources of disease outbreaks. Reservoirs are distinguished from vectors (DISEASE VECTORS) and carriers, which are agents of disease transmission rather than continuing sources of potential disease outbreaks.Horse Diseases: Diseases of domestic and wild horses of the species Equus caballus.Animal Nutritional Physiological Phenomena: Nutritional physiology of animals.Probiotics: Live microbial DIETARY SUPPLEMENTS which beneficially affect the host animal by improving its intestinal microbial balance. Antibiotics and other related compounds are not included in this definition. In humans, lactobacilli are commonly used as probiotics, either as single species or in mixed culture with other bacteria. Other genera that have been used are bifidobacteria and streptococci. (J. Nutr. 1995;125:1401-12)Bacteriological Techniques: Techniques used in studying bacteria.Bacteria, AnaerobicEimeria: A genus of protozoan parasites of the subclass COCCIDIA. Various species are parasitic in the epithelial cells of the liver and intestines of man and other animals.Trichostrongyloidea: A superfamily of nematodes. Most are intestinal parasites of ruminants and accidentally in humans. This superfamily includes seven genera: DICTYOCAULUS; HAEMONCHUS; Cooperia, OSTERTAGIA; Nematodirus, TRICHOSTRONGYLUS; and Hyostrongylus.Sensitivity and Specificity: Binary classification measures to assess test results. Sensitivity or recall rate is the proportion of true positives. Specificity is the probability of correctly determining the absence of a condition. (From Last, Dictionary of Epidemiology, 2d ed)Campylobacter Infections: Infections with bacteria of the genus CAMPYLOBACTER.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Chromatography, High Pressure Liquid: Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.Urine: Liquid by-product of excretion produced in the kidneys, temporarily stored in the bladder until discharge through the URETHRA.Enterobacteriaceae: A family of gram-negative, facultatively anaerobic, rod-shaped bacteria that do not form endospores. Its organisms are distributed worldwide with some being saprophytes and others being plant and animal parasites. Many species are of considerable economic importance due to their pathogenic effects on agriculture and livestock.Sheep Diseases: Diseases of domestic and mountain sheep of the genus Ovis.Escherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.Spirochaetales: An order of slender, flexuous, helically coiled bacteria, with one or more complete turns in the helix.GeeseDefecation: The normal process of elimination of fecal material from the RECTUM.Cryptosporidium parvum: A species of parasitic protozoa that infects humans and most domestic mammals. Its oocysts measure five microns in diameter. These organisms exhibit alternating cycles of sexual and asexual reproduction.Animals, Wild: Animals considered to be wild or feral or not adapted for domestic use. It does not include wild animals in zoos for which ANIMALS, ZOO is available.Gastroenteritis: INFLAMMATION of any segment of the GASTROINTESTINAL TRACT from ESOPHAGUS to RECTUM. Causes of gastroenteritis are many including genetic, infection, HYPERSENSITIVITY, drug effects, and CANCER.Milk: The white liquid secreted by the mammary glands. It contains proteins, sugar, lipids, vitamins, and minerals.Water Microbiology: The presence of bacteria, viruses, and fungi in water. This term is not restricted to pathogenic organisms.Sewage: Refuse liquid or waste matter carried off by sewers.Paratuberculosis: A chronic GASTROENTERITIS in RUMINANTS caused by MYCOBACTERIUM AVIUM SUBSPECIES PARATUBERCULOSIS.Animals, Domestic: Animals which have become adapted through breeding in captivity to a life intimately associated with humans. They include animals domesticated by humans to live and breed in a tame condition on farms or ranches for economic reasons, including LIVESTOCK (specifically CATTLE; SHEEP; HORSES; etc.), POULTRY; and those raised or kept for pleasure and companionship, e.g., PETS; or specifically DOGS; CATS; etc.Felidae: The cat family in the order CARNIVORA comprised of muscular, deep-chested terrestrial carnivores with a highly predatory lifestyle.Zoonoses: Diseases of non-human animals that may be transmitted to HUMANS or may be transmitted from humans to non-human animals.Enteritis: Inflammation of any segment of the SMALL INTESTINE.Anaerobiosis: The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)Sheep: Any of the ruminant mammals with curved horns in the genus Ovis, family Bovidae. They possess lachrymal grooves and interdigital glands, which are absent in GOATS.Campylobacter fetus: A species of bacteria present in man and many kinds of animals and birds, often causing infertility and/or abortion.Virus Shedding: The expelling of virus particles from the body. Important routes include the respiratory tract, genital tract, and intestinal tract. Virus shedding is an important means of vertical transmission (INFECTIOUS DISEASE TRANSMISSION, VERTICAL).Coccidiosis: Protozoan infection found in animals and man. It is caused by several different genera of COCCIDIA.Clostridium perfringens: The most common etiologic agent of GAS GANGRENE. It is differentiable into several distinct types based on the distribution of twelve different toxins.Dog Diseases: Diseases of the domestic dog (Canis familiaris). This term does not include diseases of wild dogs, WOLVES; FOXES; and other Canidae for which the heading CARNIVORA is used.Intestinal Diseases, Parasitic: Infections of the INTESTINES with PARASITES, commonly involving PARASITIC WORMS. Infections with roundworms (NEMATODE INFECTIONS) and tapeworms (CESTODE INFECTIONS) are also known as HELMINTHIASIS.Food Microbiology: The presence of bacteria, viruses, and fungi in food and food products. This term is not restricted to pathogenic organisms: the presence of various non-pathogenic bacteria and fungi in cheeses and wines, for example, is included in this concept.Carnivora: An order of MAMMALS, usually flesh eaters with appropriate dentition. Suborders include the terrestrial carnivores Fissipedia, and the aquatic carnivores PINNIPEDIA.Anti-Bacterial Agents: Substances that reduce the growth or reproduction of BACTERIA.Panthera: Genus in the family FELIDAE comprised of big felines including LIONS; TIGERS; jaguars; and the leopard.Oocysts: Zygote-containing cysts of sporozoan protozoa. Further development in an oocyst produces small individual infective organisms called SPOROZOITES. Then, depending on the genus, the entire oocyst is called a sporocyst or the oocyst contains multiple sporocysts encapsulating the sporozoites.Dysentery: Acute inflammation of the intestine associated with infectious DIARRHEA of various etiologies, generally acquired by eating contaminated food containing TOXINS, BIOLOGICAL derived from BACTERIA or other microorganisms. Dysentery is characterized initially by watery FECES then by bloody mucoid stools. It is often associated with ABDOMINAL PAIN; FEVER; and DEHYDRATION.Starch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Ileum: The distal and narrowest portion of the SMALL INTESTINE, between the JEJUNUM and the ILEOCECAL VALVE of the LARGE INTESTINE.Haemonchus: A genus of parasitic nematode worms which infest the duodenum and stomach of domestic and wild herbivores, which ingest it with the grasses (POACEAE) they eat. Infestation of man is accidental.Nematode Infections: Infections by nematodes, general or unspecified.Clostridium Infections: Infections with bacteria of the genus CLOSTRIDIUM.Enterococcus: A genus of gram-positive, coccoid bacteria consisting of organisms causing variable hemolysis that are normal flora of the intestinal tract. Previously thought to be a member of the genus STREPTOCOCCUS, it is now recognized as a separate genus.Biological Availability: The extent to which the active ingredient of a drug dosage form becomes available at the site of drug action or in a biological medium believed to reflect accessibility to a site of action.Bacterial Typing Techniques: Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.Specimen Handling: Procedures for collecting, preserving, and transporting of specimens sufficiently stable to provide accurate and precise results suitable for clinical interpretation.Helicobacter: A genus of gram-negative, spiral-shaped bacteria that has been isolated from the intestinal tract of mammals, including humans. It has been associated with PEPTIC ULCER.Animals, ZooRandom Allocation: A process involving chance used in therapeutic trials or other research endeavor for allocating experimental subjects, human or animal, between treatment and control groups, or among treatment groups. It may also apply to experiments on inanimate objects.Mycobacterium avium subsp. paratuberculosis: A subspecies of gram-positive, aerobic bacteria. It is the etiologic agent of Johne's disease (PARATUBERCULOSIS), a chronic GASTROENTERITIS in RUMINANTS.Serotyping: Process of determining and distinguishing species of bacteria or viruses based on antigens they share.Rectum: The distal segment of the LARGE INTESTINE, between the SIGMOID COLON and the ANAL CANAL.Animal Husbandry: The science of breeding, feeding and care of domestic animals; includes housing and nutrition.Cestode Infections: Infections with true tapeworms of the helminth subclass CESTODA.Time Factors: Elements of limited time intervals, contributing to particular results or situations.Lithocholic Acid: A bile acid formed from chenodeoxycholate by bacterial action, usually conjugated with glycine or taurine. It acts as a detergent to solubilize fats for absorption and is itself absorbed. It is used as cholagogue and choleretic.Clostridium difficile: A common inhabitant of the colon flora in human infants and sometimes in adults. It produces a toxin that causes pseudomembranous enterocolitis (ENTEROCOLITIS, PSEUDOMEMBRANOUS) in patients receiving antibiotic therapy.Deoxycholic Acid: A bile acid formed by bacterial action from cholate. It is usually conjugated with glycine or taurine. Deoxycholic acid acts as a detergent to solubilize fats for intestinal absorption, is reabsorbed itself, and is used as a choleretic and detergent.Rumen: The first stomach of ruminants. It lies on the left side of the body, occupying the whole of the left side of the abdomen and even stretching across the median plane of the body to the right side. It is capacious, divided into an upper and a lower sac, each of which has a blind sac at its posterior extremity. The rumen is lined by mucous membrane containing no digestive glands, but mucus-secreting glands are present in large numbers. Coarse, partially chewed food is stored and churned in the rumen until the animal finds circumstances convenient for rumination. When this occurs, little balls of food are regurgitated through the esophagus into the mouth, and are subjected to a second more thorough mastication, swallowed, and passed on into other parts of the compound stomach. (From Black's Veterinary Dictionary, 17th ed)Chickens: Common name for the species Gallus gallus, the domestic fowl, in the family Phasianidae, order GALLIFORMES. It is descended from the red jungle fowl of SOUTHEAST ASIA.Digestive System Physiological Phenomena: Properties and processes of the DIGESTIVE SYSTEM as a whole or of any of its parts.Goat Diseases: Diseases of the domestic or wild goat of the genus Capra.Goats: Any of numerous agile, hollow-horned RUMINANTS of the genus Capra, in the family Bovidae, closely related to the SHEEP.Bird Diseases: Diseases of birds not considered poultry, therefore usually found in zoos, parks, and the wild. The concept is differentiated from POULTRY DISEASES which is for birds raised as a source of meat or eggs for human consumption, and usually found in barnyards, hatcheries, etc.Housing, AnimalImmunomagnetic Separation: A cell-separation technique where magnetizable microspheres or beads are first coated with monoclonal antibody, allowed to search and bind to target cells, and are then selectively removed when passed through a magnetic field. Among other applications, the technique is commonly used to remove tumor cells from the marrow (BONE MARROW PURGING) of patients who are to undergo autologous bone marrow transplantation.Glucuronides: Glycosides of GLUCURONIC ACID formed by the reaction of URIDINE DIPHOSPHATE GLUCURONIC ACID with certain endogenous and exogenous substances. Their formation is important for the detoxification of drugs, steroid excretion and BILIRUBIN metabolism to a more water-soluble compound that can be eliminated in the URINE and BILE.Rodent Diseases: Diseases of rodents of the order RODENTIA. This term includes diseases of Sciuridae (squirrels), Geomyidae (gophers), Heteromyidae (pouched mice), Castoridae (beavers), Cricetidae (rats and mice), Muridae (Old World rats and mice), Erethizontidae (porcupines), and Caviidae (guinea pigs).DairyingCholestanol: A cholesterol derivative found in human feces, gallstones, eggs, and other biological matter.Intestine, Small: The portion of the GASTROINTESTINAL TRACT between the PYLORUS of the STOMACH and the ILEOCECAL VALVE of the LARGE INTESTINE. It is divisible into three portions: the DUODENUM, the JEJUNUM, and the ILEUM.Bacteroidetes: A phylum of bacteria comprised of three classes: Bacteroides, Flavobacteria, and Sphingobacteria.Genes, rRNA: Genes, found in both prokaryotes and eukaryotes, which are transcribed to produce the RNA which is incorporated into RIBOSOMES. Prokaryotic rRNA genes are usually found in OPERONS dispersed throughout the GENOME, whereas eukaryotic rRNA genes are clustered, multicistronic transcriptional units.Foxes: Any of several carnivores in the family CANIDAE, that possess erect ears and long bushy tails and are smaller than WOLVES. They are classified in several genera and found on all continents except Antarctica.Birds: Warm-blooded VERTEBRATES possessing FEATHERS and belonging to the class Aves.Meat: The edible portions of any animal used for food including domestic mammals (the major ones being cattle, swine, and sheep) along with poultry, fish, shellfish, and game.RNA, Bacterial: Ribonucleic acid in bacteria having regulatory and catalytic roles as well as involvement in protein synthesis.Metagenome: A collective genome representative of the many organisms, primarily microorganisms, existing in a community.Bacterial Load: Measurable quantity of bacteria in an object, organism, or organism compartment.Phosphorus: A non-metal element that has the atomic symbol P, atomic number 15, and atomic weight 31. It is an essential element that takes part in a broad variety of biochemical reactions.ArtiodactylaParasitology: The study of parasites and PARASITIC DISEASES.Half-Life: The time it takes for a substance (drug, radioactive nuclide, or other) to lose half of its pharmacologic, physiologic, or radiologic activity.Aeromonas: A genus of gram-negative, facultatively anaerobic, rod-shaped bacteria that occurs singly, in pairs, or in short chains. Its organisms are found in fresh water and sewage and are pathogenic to humans, frogs, and fish.Coccidia: A subclass of protozoans commonly parasitic in the epithelial cells of the intestinal tract but also found in the liver and other organs. Its organisms are found in both vertebrates and higher invertebrates and comprise two orders: EIMERIIDA and EUCOCCIDIIDA.Cat Diseases: Diseases of the domestic cat (Felis catus or F. domesticus). This term does not include diseases of the so-called big cats such as CHEETAHS; LIONS; tigers, cougars, panthers, leopards, and other Felidae for which the heading CARNIVORA is used.Giardia lamblia: A species of parasitic EUKARYOTES that attaches itself to the intestinal mucosa and feeds on mucous secretions. The organism is roughly pear-shaped and motility is somewhat erratic, with a slow oscillation about the long axis.Shiga Toxin 1: A toxin produced by certain pathogenic strains of ESCHERICHIA COLI such as ESCHERICHIA COLI O157. It is closely related to SHIGA TOXIN produced by SHIGELLA DYSENTERIAE.Bacterial Toxins: Toxic substances formed in or elaborated by bacteria; they are usually proteins with high molecular weight and antigenicity; some are used as antibiotics and some to skin test for the presence of or susceptibility to certain diseases.Injections, Intravenous: Injections made into a vein for therapeutic or experimental purposes.DNA Primers: Short sequences (generally about 10 base pairs) of DNA that are complementary to sequences of messenger RNA and allow reverse transcriptases to start copying the adjacent sequences of mRNA. Primers are used extensively in genetic and molecular biology techniques.Botulism: A disease caused by potent protein NEUROTOXINS produced by CLOSTRIDIUM BOTULINUM which interfere with the presynaptic release of ACETYLCHOLINE at the NEUROMUSCULAR JUNCTION. Clinical features include abdominal pain, vomiting, acute PARALYSIS (including respiratory paralysis), blurred vision, and DIPLOPIA. Botulism may be classified into several subtypes (e.g., food-borne, infant, wound, and others). (From Adams et al., Principles of Neurology, 6th ed, p1208)Anthelmintics: Agents destructive to parasitic worms. They are used therapeutically in the treatment of HELMINTHIASIS in man and animal.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.Gastrointestinal Transit: Passage of food (sometimes in the form of a test meal) through the gastrointestinal tract as measured in minutes or hours. The rate of passage through the intestine is an indicator of small bowel function.Prevotella: A genus of gram-negative, anaerobic, nonsporeforming, nonmotile rods. Organisms of this genus had originally been classified as members of the BACTEROIDES genus but overwhelming biochemical and chemical findings in 1990 indicated the need to separate them from other Bacteroides species, and hence, this new genus was established.Strongyloides: A genus of parasitic nematodes widely distributed as intestinal parasites of mammals.Mass Spectrometry: An analytical method used in determining the identity of a chemical based on its mass using mass analyzers/mass spectrometers.Base Composition: The relative amounts of the PURINES and PYRIMIDINES in a nucleic acid.Environmental Microbiology: The study of microorganisms living in a variety of environments (air, soil, water, etc.) and their pathogenic relationship to other organisms including man.Enterocolitis: Inflammation of the MUCOSA of both the SMALL INTESTINE and the LARGE INTESTINE. Etiology includes ISCHEMIA, infections, allergic, and immune responses.Chromatography, Thin Layer: Chromatography on thin layers of adsorbents rather than in columns. The adsorbent can be alumina, silica gel, silicates, charcoals, or cellulose. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Lactobacillus acidophilus: A species of gram-positive, rod-shaped bacteria isolated from the intestinal tract of humans and animals, the human mouth, and vagina. This organism produces the fermented product, acidophilus milk.Deer: The family Cervidae of 17 genera and 45 species occurring nearly throughout North America, South America, and Eurasia, on most associated continental islands, and in northern Africa. Wild populations of deer have been established through introduction by people in Cuba, New Guinea, Australia, New Zealand, and other places where the family does not naturally occur. They are slim, long-legged and best characterized by the presence of antlers. Their habitat is forests, swamps, brush country, deserts, and arctic tundra. They are usually good swimmers; some migrate seasonally. (Walker's Mammals of the World, 5th ed, p1362)SvalbardRuminants: A suborder of the order ARTIODACTYLA whose members have the distinguishing feature of a four-chambered stomach, including the capacious RUMEN. Horns or antlers are usually present, at least in males.Crows: Common name for the largest birds in the order PASSERIFORMES, family Corvidae. These omnivorous black birds comprise most of the species in the genus Corvus, along with ravens and jackdaws (which are often also referred to as crows).Brachyspira: A genus of spiral bacteria of the family Brachyspiraceae.Houseflies: Flies of the species Musca domestica (family MUSCIDAE), which infest human habitations throughout the world and often act as carriers of pathogenic organisms.Methane: The simplest saturated hydrocarbon. It is a colorless, flammable gas, slightly soluble in water. It is one of the chief constituents of natural gas and is formed in the decomposition of organic matter. (Grant & Hackh's Chemical Dictionary, 5th ed)Haemonchiasis: Infection with nematodes of the genus HAEMONCHUS, characterized by digestive abnormalities and anemia similar to that from hookworm infestation.Intestinal Mucosa: Lining of the INTESTINES, consisting of an inner EPITHELIUM, a middle LAMINA PROPRIA, and an outer MUSCULARIS MUCOSAE. In the SMALL INTESTINE, the mucosa is characterized by a series of folds and abundance of absorptive cells (ENTEROCYTES) with MICROVILLI.Perissodactyla: An order of ungulates having an odd number of toes, including the horse, tapir, and rhinoceros. (Dorland, 27th ed)Chlortetracycline: A TETRACYCLINE with a 7-chloro substitution.Yogurt: A slightly acid milk food produced by fermentation due to the combined action of Lactobacillus acidophilus and Streptococcus thermophilus.Cytotoxins: Substances that are toxic to cells; they may be involved in immunity or may be contained in venoms. These are distinguished from CYTOSTATIC AGENTS in degree of effect. Some of them are used as CYTOTOXIC ANTIBIOTICS. The mechanism of action of many of these are as ALKYLATING AGENTS or MITOSIS MODULATORS.Coproporphyrins: Porphyrins with four methyl and four propionic acid side chains attached to the pyrrole rings. Elevated levels of Coproporphyrin III in the urine and feces are major findings in patients with HEREDITARY COPROPORPHYRIA.Methanobacteriales: An order of anaerobic, coccoid to rod-shaped methanogens, in the kingdom EURYARCHAEOTA. They are nonmotile, do not catabolize carbohydrates, proteinaceous material, or organic compounds other than formate or carbon monoxide, and are widely distributed in nature.Stomach, RuminantStrongyloidea: A superfamily of strongyles or roundworms which are parasites in the intestinal tract of equines, pigs, rodents, and primates (including man). It includes the genera Cyasthostomum, Ransomus, Globocephalus, OESOPHAGOSTOMUM, and STRONGYLUS.Cats: The domestic cat, Felis catus, of the carnivore family FELIDAE, comprising over 30 different breeds. The domestic cat is descended primarily from the wild cat of Africa and extreme southwestern Asia. Though probably present in towns in Palestine as long ago as 7000 years, actual domestication occurred in Egypt about 4000 years ago. (From Walker's Mammals of the World, 6th ed, p801)Balantidium: A genus of protozoa parasitic in the digestive tract of vertebrate or invertebrate hosts. Asexual multiplication is accomplished by transverse binary fission. Its organisms are ovoidal in shape and have a ciliated covering over the entire body.Veillonellaceae: A family of gram-negative bacteria, in the phylum FIRMICUTES.Food Contamination: The presence in food of harmful, unpalatable, or otherwise objectionable foreign substances, e.g. chemicals, microorganisms or diluents, before, during, or after processing or storage.Macaca fascicularis: A species of the genus MACACA which typically lives near the coast in tidal creeks and mangrove swamps primarily on the islands of the Malay peninsula.Meat Products: Articles of food which are derived by a process of manufacture from any portion of carcasses of any animal used for food (e.g., head cheese, sausage, scrapple).Campylobacter jejuni: A species of bacteria that resemble small tightly coiled spirals. Its organisms are known to cause abortion in sheep and fever and enteritis in man and may be associated with enteric diseases of calves, lambs, and other animals.Antibiosis: A natural association between organisms that is detrimental to at least one of them. This often refers to the production of chemicals by one microorganism that is harmful to another.Seasons: Divisions of the year according to some regularly recurrent phenomena usually astronomical or climatic. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Dietary Carbohydrates: Carbohydrates present in food comprising digestible sugars and starches and indigestible cellulose and other dietary fibers. The former are the major source of energy. The sugars are in beet and cane sugar, fruits, honey, sweet corn, corn syrup, milk and milk products, etc.; the starches are in cereal grains, legumes (FABACEAE), tubers, etc. (From Claudio & Lagua, Nutrition and Diet Therapy Dictionary, 3d ed, p32, p277)Pediculus: Lice of the genus Pediculus, family Pediculidae. Pediculus humanus corporus is the human body louse and Pediculus humanus capitis is the human head louse.Cestoda: A subclass of segmented worms comprising the tapeworms.

*  Half of U.S. public pools contaminated by feces
contaminated by feces. . Right now. Today's high. Today's ... contaminated by feces. By Anna Edney, Bloomberg News. ... WASHINGTON -- Human feces taints more than half of public ... Half of U.S. public pools contaminated by feces. Today's high. Full weather report. Full traffic report. News. Weather. Traffic. News. Local News. Blogs. National News Video. Traffic. Video. Weather. Sports. Local Sports. Blogs. National Sports Video. Video. Blogs. Video. Blogs. Video. Today's Ads. Email Newsletter Sign up. RSS. Twitter. Pinterest. Email. Home → News. Half of U.S. public pools contaminated by feces. WASHINGTON -- Human feces taints more than half of public swimming pools, a finding U.S. E coli, which indicates the presence of fecal matter, was detected in 58 percent of samples taken from pool filters by the U.S. Pools frequented mostly by children were more likely to test positive for E. Municipal pools open to all were worse than public pools requiring membership, the CDC said. Acute gastrointestinal ill...
*  Home Page
through uncollected feces. Because many dogs have a propensity ... home page pet waste removal service we ll take the crap so you don t have to home rates sign up faq s payment products contact don t embarrass your dog when he has friends over if your dog could he d beg you for the service make him smile and give us a call today for as little as a week wholly crap will clean your yard of that nasty dog waste there are many advantages to keeping your yard clean dog waste compromises the appearance of your yard attracts flies and other pests pollutes ground water offends the neighbors and most significantly endangers the health of your pets and your family dog waste removal services exist to make life more pleasant for dog owners by eliminating the most unpleasant aspects of dog ownership at a surprisingly low cost sign up now unless you have the perfect dog you can sign up now by using our online sign up form contacting us through email or picking up the phone and giving us a call you won t be sorry that you...
*  Carpet Cleaning Bellevue WA | Upholstery Cleaning Bellevue WA | Pet Odor Solutions Bellevue WA
daily waste and feces of up to 200 times their body weight. ... Carpet Cleaning Bellevue WA. Upholstery Cleaning Bellevue WA. Pet Odor Solutions Bellevue WA. Carpet Cleaning Tips. Schedule Appointment. steam cleaning. allergens. Walking on the carpet crushes the pollutants deep into carpet fibers which makes them unreachable by vacuums and often overlooked by professional cleaners. If left untreated, the small particles attract Dust Mites which are microscopic bugs that leave behind daily waste and feces of up to 200 times their body weight. Even though the original pollutants are embedded tight in the fibers of your carpet, body parts and left overs from the dust mites can easily be inhaled when the area is disturbed. Without getting rid of these common critters AND their left overs you may be leaving your family subject to airborne illness, skin irritations and sinus irritations that contribute to sneezing, snoring and asthma. But you can have a clean, comfortable carpet that looks like new, smells great,...
*  Effect of a Dog Park on Water Quality in an Adjacent River :: CCSU Theses & Dissertations
found in dog feces , a realistic health concern exists if feces from the dog park contaminate the water ... Effect of a Dog Park on Water Quality in an Adjacent River :: CCSU Theses & Dissertations. CCSU Theses and Dissertations. Add or remove collections. CCSU Theses & Dissertations Effect of a Dog Park on Water Quality in an Adjacent River. Effect of a Dog Park on Water Quality in an Adjacent River. small 250x250 max medium 500x500 max Large Extra Large large > 500x500 Full Resolution. Title Effect of a Dog Park on Water Quality in an Adjacent River. With the large number of different pathogens found in dog feces, a realistic health concern exists if feces from the dog park contaminate the water. The purpose of this study was to determine whether a popular dog exercise area in Southbury, CT, with 457 meters of direct access to the Pomperaug River, influences the physical and microbial characteristics of the river. Water was sampled from two locations, one area upstream from the dog park and the other area a...
*  Geese feces health risks? | Go Ask Alice!
Geese feces health risks. Go Ask Alice. Skip to ... New Q As ›. Geese feces health risks. Geese feces health risks ... and playing in this feces. Dear Reader, Canada geese feces can ... Geese feces health risks. Go Ask Alice. Recent Q As Alcohol Other Drugs Emotional Health General Health Nutrition Physical Activity Relationships Sexual Reproductive Health Themes Fact Sheets. About Alice. All About Alice. Go Ask Alice. Get Alice. Geese feces health risks. Geese feces health risks. I am wondering what the health risks are to children as well as to adults sitting and playing in this feces. Dear Reader, Canada geese feces can be hazardous to people's health, but usually only when inhaled or ingested. Walking past geese feces, or even lounging near them on the beach is likely safe for healthy people. However, the elderly, children, and pregnant or breastfeeding women are particularly susceptible to health risks posed by parasites that inhabit Canada geese feces. Similarly, people with gastrointestinal GI p...
*  Interpretation for 8310 Fat, Feces
for 8310 Fat, Feces. Search Mayo Medical Laboratories ... Interpretation for 8310 Fat, Feces. Test Catalog Test Information New Tests Test Updates Reflex Tests Referred Tests NYS Informed Consent Test List Download Catalog References Critical Values and Semi-Urgent Results Performing Locations Policies. Setup Information Test Setup AOE Codes LOINC Codes Units of Measurement. Test Ordering MayoACCESS Overview References MayoLINK Overview References. Specimen Handling Collection and Preparation Instructions by Specimen Type Category A Infectious Substances Light Protection Tests Microbiology Culture Tests Resources Supply Catalog FAQ Dangerous Goods Training. My Account Report Portal Client Price Portal Additional Test Report Quality Report Portal Reportable Disease Portal Electronic Invoices Supply Catalog. Test 8310 : Fat, Feces Clinical Information. Steatorrhea increased fecal excretion of fat may reflect a number of pancreatic or intestinal disorders, including chronic pancreatitis with or without stone o...
*  Japan scientist synthesizes meat from human feces | Digital Trends
meat from human feces. Digital Trends. DT Digital Trends. ... meat from human feces. Japan scientist synthesizes meat from ... human feces By. Jeff Hughes. June 15, 2011. 194 ... Japan scientist synthesizes meat from human feces. Digital Trends. DT Digital Trends. DT Digital Trends. Product Reviews Phones. Laptops. Cars. Tablets. Headphones. Cameras. Wearables. More Reviews. Cars. DT Home. Wearables. Cool Tech. More News. Videos Features Deals Giveaways Best Of Everything DT en Español The Manual More Advertise. DT en Español. The Manual. Best Cell Phones Best TVs Best Headphones Best Cameras Best Laptops Best Desktop PCs Best Tablets Best Cars RSS. DT Newsletter. Cool Tech. Japan scientist synthesizes meat from human feces. Japan scientist synthesizes meat from human feces By. Get our top stories and more Delivered to your inbox for free. Synthesize food from human waste matter. Absurd yes, but Japanese scientists have actually discovered a way to create edible steaks from human feces. Mitsuyuki Ik...
*  Dung | Definition of dung by Merriam-Webster
of DUNG 1 : the feces of an animal : manure. 2 : something ... , excreta , feces , ordure , poop , scat , slops , soil ... Dung. Definition of dung by Merriam-Webster. Join Us On. An Encyclop dia Britannica Company Dictionary Thesaurus Medical Scrabble. Spanish Central. Browse Dictionary Browse Thesaurus Get our free apps. Word of the Day. Blog: Words at Play. Dictionary 1 dung. noun \ ˈ dəŋ\ : solid waste from an animal. Full Definition of DUNG 1 : the feces of an animal : manure. See dung defined for English-language learners. See dung defined for kids. ADVERTISEMENT. Origin of DUNG Middle English, from Old English; akin to Old Norse dyngja manure pile First Known Use: before 12th century. Related to DUNG Synonyms dirt, doo-doo, dropping, excrement, excreta, feces, ordure, poop, scat, slops, soil, waste. 2 dung verb. Definition of DUNG transitive verb : to fertilize or dress with manure. First Known Use of DUNG before 12th century. DUNG Defined for Kids. dung noun. Definition of DUNG for Kids : solid was...
*  A1AF - Specimen: Alpha-1-Antitrypsin, Random, Feces
, Random, Feces. Mobile Site. Search Mayo Medical ... A1AF - Specimen: Alpha-1-Antitrypsin, Random, Feces. Search Mayo Medical Laboratories Search. Test Catalog Go Test Name A. Test Catalog Test Information New Tests Test Updates Reflex Tests Referred Tests NYS Informed Consent Test List Download Catalog References Critical Values and Semi-Urgent Results Performing Locations Policies. Setup Information Test Setup AOE Codes LOINC Codes Units of Measurement. New Tests. Setup Information. Critical Values and Semi-Urgent Results. Referred Tests. NYS Informed Consent Test List. Test Ordering MayoACCESS Overview References MayoLINK Overview References. Specimen Handling Collection and Preparation Instructions by Specimen Type Category A Infectious Substances Light Protection Tests Microbiology Culture Tests Resources Supply Catalog FAQ Dangerous Goods Training. Specimen Transport Customized Shipping Instructions Shipping Guides Courier Instructions Transportation Regulations CDC Permit. Outreach Resources Outrea...
*  .. Dust Mites Make People Vulnerable to All Allergens .. Categories .. Social .. Archives .. Additi
enzyme in dust mite feces destroys the protective barrier of the ... Dust Mites Make People Vulnerable to All Allergens September 29, 2006. Archives Archives Select Month September 2015 August 2015 May 2015 April 2015 March 2015 February 2015 January 2015 December 2014 November 2014 October 2014 September 2014 August 2014 July 2014 June 2014 May 2014 April 2014 March 2014 February 2014 January 2014 December 2013 November 2013 October 2013 September 2013 August 2013 July 2013 June 2013 May 2013 April 2013 March 2013 February 2013 January 2013 December 2012 November 2012 October 2012 September 2012 August 2012 July 2012 June 2012 May 2012 April 2012 March 2012 February 2012 January 2012 December 2011 November 2011 October 2011 September 2011 August 2011 July 2011 June 2011 May 2011 April 2011 March 2011 February 2011 January 2011 December 2010 November 2010 October 2010 September 2010 August 2010 July 2010 June 2010 May 2010 April 2010 March 2010 February 2010 January 2010 December 2009 November 2009 October 2...
*  .. Common Beef Cattle Diseases You Should Be Aware Of .. Beef cattle diseases can be prevented with
Common Beef Cattle Diseases You Should Be Aware Of. As a cattle owner, you should be aware of the diseases that may affect your cows. Parasite infection, for instance, is one of the most common beef cattle diseases. External parasites such as horn flies and lice are common during the summer and the winter respectively. Both can be controlled, however, with proper medication. Internal parasites, on the other hand, can be fatal especially to calves under one year of age. These young calves have not yet developed a certain degree of immunity that can help them survive infections. So, in order to get rid of the parasites, deworming is necessary. You may use anthelmintics that have been approved for beef cattle. Consult a veterinarian with regard to the type of wormer as well as the right timing for medication. Some of the popular brands are Safeguard, Valbazen, Ivomec, Levisol, and Rumatel. Safeguard contains fenbendazole as its active ingredient. It is effective against lungworms, roundworms, and larval forms. V...
*  Deadly cattle disease eliminated - Telegraph
... < img alt="dcsimg" id="dcsimg" width="1" height="1" src="// 4o2o/njs.gif?MLC= Channel= Genre= Category= Content Type= Level= source= dcsuri=/nojavascript WT.js=No"/>. Search - enhanced by OpenText. Video. News. Finance. TV. Politics. Education. Earth. Royal. Celebrity. Defence. News. Earth Video. Advertisement. News. Earth. Farming. Deadly cattle disease eliminated Defeat of Rinderpest is only second time after smallpox that mankind has eliminated a disease. Scientists are poised to eliminate the deadly cattle disease Rinderpest, ending a malady that has devastated animal herds for centuries, the United Nations Food and Agriculture Organisation said. "It would be the first time in history that humankind has succeeded in wiping out an animal disease in the wild, and only the second time, after smallpox in 1980, that a disease has been eliminated thanks to human efforts," the FAO said in a statement....
*  Researchers to study causes of stillborn calves | Dairy Herd Management
Researchers to study causes of stillborn calves. Dairy Herd Management. Skip to main content. Close Menu. Home. News. Industry Markets USDA Market Reports Products. Advice + Tips. Animal Health Center Quality Silage Calf Heifer Reproduction Nutrition Performance Through Nutrition. Quotes + Weather. Quotes and Charts Weather Forecast Weather Radar Precipitation. Video Events + Contests. Calendar World Dairy Expo 40 Under 40 Dairy Herd Innovation Awards 2015. Community. Contributors. Magazine Buyers Guide. Art s Way Precision Dairy Calf Heifer Health Feed Feed Additives Hay Forage Equipment Balers Mastitis Control Utility Tractors Silage Equipment Management Fly and Parasite Control. Webinars Facebook Link. Twitter Link. Instagram Link. RSS Index Link. Menu. Dairy Herd Management. . Click here for navigation menu. Facebook Link. Twitter Link. Instagram Link. RSS Index Link. . Connect with us on Facebook, Twitter and Instagram. Welcome. My Profile Join Sign In. Search form. Search. News World Dairy Expo Quality ...
*  Cows, Sheep, Pigs News -- ScienceDaily
... Cows, Sheep, Pigs News. October 5, 2015. read more. read more. read more. Changes in Dairy Industry Benefit Dairy Cattle Health, Consumers. 22, 2015 Profound changes in the dairy industry in recent decades have benefited the health and welfare of dairy cows, as well as consumers. read more. Cattle Disease Spread by Vets, Not Cows. 21, 2015 A cattle disease that affected more than 5,000 cows, over 500 of which were killed, was probably spread by vets farmers and cattle traders in Germany, according to a new article. read more. read more. read more. read more. read more. read more. Mimicry Helps Sheep Solve a Dilemma High Dietary Fiber Intake Linked to Health The Life of Domesticated Cheese-Making Fungi Changes in Dairy Industry Benefit Cattle Health Cattle Disease Spread by Vets, Not Cows Virus in Cattle Linked to Human Breast Cancer Eating Fish: Understanding Risks, Benefits MicroRNAs Are Digested, Not Absorbed Combating Multi-Resistant Bacteria in Stables Rewriting Genetic History of Sheep. Latest Video...,_sheep,_pigs/
*  Calf Scours: Causes, prevention and treatment | Cattle Network
My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage Quotes + Weather. Drovers/CattleNetwork Cow/Calf Producer Drovers Cow/Calf Buyers Guide. Drovers Cattle Network. Baby Calf Health Calf Scours: Causes, prevention and treatment. Calf scours is not a single disease; it is a clinical sign associated with several diseases characterized by diarrhea. Causes of Calf Scours The known causes of scours are grouped into two categories: 1 noninfectious causes, and 2 infectious causes. Noninfectious Causes of Calf Scours Noninfectious causes are best defined as flaws in management which appear as nutritional shortcomings, inadequate environment, insufficient attention to the newborn calf, or a combination of these. The calf will acquire these antibodies only by nursing colostrum early in life. Coli + cryptosporidium or coronavirus + salmonella, etc. Coli scours infections from the environment, particularly when sanitation is marginal. ...
*  Milk Price War Pits California Dairy Farms Against Cheesemakers |
Current News Krone Releases New BiG Pack Large Square MultiBaler Saturday, October 3, 2015 Minnesota Remains Top Turkey-Producing State Saturday, October 3, 2015 Beef Genetics Make Jersey Bull Calves 10-times as Profitable Friday, October 2, 2015. Current News Krone Releases New BiG Pack Large Square MultiBaler Saturday, October 3, 2015 Minnesota Remains Top Turkey-Producing State Saturday, October 3, 2015 Beef Genetics Make Jersey Bull Calves 10-times as Profitable Friday, October 2, 2015. Beef Cattle Markets. Beef Cattle Markets Home Check Cattle Prices. Current News French Cows Dining on Wheat Instead of Corn After Mega Harvest Friday, October 2, 2015 Freezer Beef 101 Wednesday, September 30, 2015 Market Highlights: Have Cattle Prices Hit Rock Bottom. Krone Releases New BiG Pack Large Square MultiBaler By News Release. Current News Beef Genetics Make Jersey Bull Calves 10-times as Profitable Friday, October 2, 2015 Cover Crop Forages: The Nitrate Dilemma Friday, October 2, 2015 A Look at Johne's Disease Fr...
*  California Dairies at a Pivotal Point, Says Rabobank |
California Dairies at a Pivotal Point, Says Rabobank. Skip to main content. Sign Up Login. My Account / Logout. Discussions. Newsletters. Events. Farm Journal Store. Visit all Farm Journal brands Ag Day TV AgriTalk Beef Today Commodity Update Dairy Today Farm Journal Farm Journal Foundation Legacy Project Machinery Pete Market Rally Radio Pro Farmer Top Producer Top Producer Executive Network US Farm Report. Tuesday, October 06, 2015. Home. Farm Journal Home Farm Journal Forum. Farm Journal Pulse. Bob Utterback. Machinery Pete. What A Day. Worker at Arizona Dairy Farm Accused of Killing Cows By Associated Press. Current News Iowa Growers Say Rain Hasn't Dented Their Pumpkin Crop. Monday, October 5, 2015 Two New Major Corn Exporters Emerge Monday, October 5, 2015 Why It's Important to Monitor Crop Diseases at Harvest Friday, October 2, 2015. Magazine. Magazine Home Current Issue. Archive. Subscribe. Worker at Arizona Dairy Farm Accused of Killing Co...
*  Difficult to anticipate Dec. 1 corn stocks estimate | Cattle Network
My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage. Drovers/CattleNetwork Cow/Calf Producer. Drovers Cattle Network. The estimate of soybean stocks may be somewhat less important because more is known about the level of consumption during the first quarter of the 2012-13 marketing year, according to University of Illinois agricultural economist Darrel Good. Total consumption during the quarter was likely near 1.176 billion bushels. “If the final estimate of crop size is near the November forecast, Dec. According to Good, the magnitude of corn stocks on Dec. 1 will reveal the magnitude of consumption during the first quarter of the marketing year and the amount of corn available for consumption during the final three-quarters of the year. “In addition, the magnitude of stocks will be influenced by the imports of corn during the first quarter of the marketing year. For the year, the USDA has forecast imports of 100 million b...
*  Wisconsin's 2013 crop year: A year of extremes | Cattle Network
My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage Quotes + Weather. Drovers/CattleNetwork Cow/Calf Producer Drovers Cow/Calf Buyers Guide. Drovers Cattle Network. Fall tillage was 63 percent complete statewide on November 25, 9 percentage points behind the five year average. Statewide temperatures from June to September were 0.1 degrees above normal in 2013, compared to 2.0 degrees above normal in 2012. April through August had below normal temperatures, with April averaging 6.4 degrees below normal. September had above normal temperatures, averaging 2.0 degrees above normal. Total precipitation in the northern third of the state was 1.22 inches above normal for April through September, the central third of the state was 0.86 inches below normal, and the southern third of the state was 4.13 inches above normal. Statewide, April through June had above normal precipitation, while July through September had below normal prec...
*  Agri-Pulse guest Op-Ed: Don’t complain with your mouth full | Cattle Network
My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage Quotes + Weather. Drovers/CattleNetwork Cow/Calf Producer Drovers Cow/Calf Buyers Guide. News Quality Silage My Beef Checkoff Drovers Cow/Calf Quotes Subscribe. In just about every walk of life, we look for ways to manage risk. Insurance protection is available to protect our families, our health, our homes, our vehicles. It only makes sense that insurance protection should be available to help farmers and ranchers produce something that everyone must have to survive: the nation’s food supply. Unfortunately, critics have filed short-sighted amendments that would return us to the days of 100% taxpayer-funded ad hoc crop disaster assistance and government delivery of crop insurance. In short, these amendments to impose means testing, cap premium support and cut private sector delivery create barriers to participation and jeopardize crop insurance protection, which is necessa...
*  R-CALF: Group Praises Vilsack For His Concerns About NCBA, Beef Checkoff | Cattle Network
R-CALF: Group Praises Vilsack For His Concerns About NCBA, Beef Checkoff. My Beef Checkoff Cattle Disease Diagnostics Drovers Cow/Calf Cow Calf Cattle Feeding Pasture Rangeland Animal Health Center Quality Silage Quotes + Weather. News Quality Silage My Beef Checkoff Drovers Cow/Calf Quotes Subscribe. Industry R-CALF: Group Praises Vilsack For His Concerns About NCBA, Beef Checkoff. “R-CALF USA members who pay the Checkoff believe they are underrepresented in the Checkoff program because it is unduly influenced by NCBA and we share Secretary Vilsack’s concerns and support his efforts to ensure the independence of the Federation from the control exerted by any private membership organization, regardless of its Checkoff contractor status,” said R-CALF USA Region VII Director Joel Gill, who chairs the group’s Checkoff committee. “While NCBA, or any group, has the right to restructure its organization, we at R-CALF USA believe the proposed NCBA restructuring has ramifications that go far beyond the limited number...
*  Vomiting feces
... redirect fecal vomiting...
*  Safety evaluation of Bifidobacterium pseudocatenulatum G4 as assessed in BALB/c mice - Universiti
... Putra Malaysia Institutional Repository. Keyword Search:. Faculty and Institute. Item Type. Safety evaluation of Bifidobacterium pseudocatenulatum G4 as assessed in BALB/c mice. Yazid and Wong, Stephenie Yoke Wei and Abdullah, Muhammad Nazrul Hakim and Othaman, Muhammad Anas and Mustafa, Shuhaimi 2008 Safety evaluation of Bifidobacterium pseudocatenulatum G4 as assessed in BALB/c mice. Abstract Aims: To assess the safety of Bifidobacterium pseudocatenulatum G4 in BALB/c mice that involves examination of bacterial translocation, changes in the internal organs and histology of the intestinal lining. pseudocatenulatum G4 2 × 104, 1 × 108 and 1 × 1011 CFU day−1 for 4 weeks. There were no significant differences in the internal organ liver, heart, kidney and spleen indices, serum enzymes of liver aspartate aminotransferase, alkaline phosphate, alanine aminotransferase and kidney urea and creatinine and histology villi height, crypts height, mucosa thickness and epithelial cell height of caecum, ileum and colo...
*  Bifidobacterium longum subsp. longum F8
... p>An evidence describes the source of an annotation, e.g. an experiment that has been published in the scientific literature, an orthologous protein, a record from another database, etc. /p> p> a href="/manual/evidences">More… /a> /p>. Taxonomy. x UniProtKB Protein knowledgebase UniParc Sequence archive Help Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef Sequence clusters Proteomes Protein sets from fully sequenced genomes Annotation systems Systems used to automatically annotate proteins with high accuracy: UniRule Manually curated rules. Supporting data Select one of the options below to target your search: Literature citations. Taxonomy. Keywords. Subcellular locations. Cross-referenced databases. Human diseases. BLAST. Align. Retrieve/ID mapping. Help. Taxonomy - Bifidobacterium longum subsp. longum F8. Basket 0 max 400 entries x Your basket is currently empty. Select item s and click on "Add to basket" to create your own collection...
*  Bifidobacterium dentium
... is a species of bacteria in the genus of bifidobacterium branch ed anaerobic bacteria from the bifidobacteriaceae family b dentium is a source of anaerobic infection s and is also tracked in polluted water to trace the source of fecal contamination scientists have shown that b dentium can cause tooth decay in humans due to its high tolerance of the acidic environments reachable by the human mouth ph b dentium can sustain growth in the oral cavities cause harm to the teeth and break down sugar carbohydrates the bifidobacterium dentium bd genome sequence reflects its genetic adaptation to the human oral cavity plos genetics n p n d web june b dentium has been identified by researchers at baylor college of medicine and texas children s hospital as producing a neurotransmitter that may play a role in preventing or treating inflammatory bowel diseases such as crohn s disease medical news today potential link between intestinal bacteria and inflammation jun accessed online june at http www medicalnewstoday com...
*  What Is Bifidobacterium Animalis? (with pictures)
What Is Bifidobacterium Animalis. wise GEEK clear answers for common questions. What Is Bifidobacterium Animalis. Bifidobacterium animalis lives in the large intestines and is required for food digestion. Most dairy products contain Bifidobacterium animalis. Eating foods high in Bifidobacterium animalis, like yogurt, may help reduce intestinal inflammation and decrease levels of harmful bacteria. Bifidobacterium animalis lives in the large intestines and is necessary for food digestion. You won't believe these 10 facts about people Top 10 amazing movie makeup transformations These 10 animal facts will amaze you Top 10 unbelievable historical concurrencies Adorable animal families that will make you "aww" These 10 facts about space will blow your mind 10 most extreme places on Earth 10 hilariously insightful foreign words Top 10 facts about the world. Eating foods that contain this "good" bacteria can provide a number of health benefits. It is known to stop harmful bacteria from growing in the digestive system...
*  Bifidobacterium breve
... home jobs news articles job advice search protocols fun reallabrat candidates post your resume candidates search biotech jobs employers post job openings email login password new users sign up home restriction enzymes sources bifidobacterium breve bifidobacterium breve biohazard level growth temperature o c appropriate growth media corynebacterium agar genomic sources for restriction enzymes at this website bbe i gram stain bifidobacterium breve is gram stain positive respiration bifidobacterium breve is anaerobic motility bifidobacterium breve is non motile taxonomic lineage bacteria actinobacteria actinobacteria class actinobacteridae bifidobacteriales bifidobacteriaceae bifidobacterium industrial uses or economic implications bifidobacteria including bifidobacterium breve have been used as probiotics miscellaneous newborns especially those that are breast fed are colonized with bifidobacteria directly after birth bifidobacteria were first isolated from the feces of breast fed infants human health and ...
*  Bifidobacterium animalis
... animalis' with the subspecies 'Bifidobacterium animalis' subsp 'animalis' and 'Bifidobacterium animalis' subsp 'lactis'. animalis' and 'B. Trade names Health effects Studies Products References External links. Several companies have attempted to trademark particular strains and, as a marketing technique, have invented scientific sounding names for the strains. Danone Dannon markets the subspecies strain as Bifidus Digestivum UK, Bifidus Regularis US and Mexico, Bifidobacterium Lactis or B.L. Regularis Canada, DanRegularis Brazil, Bifidus Actiregularis Argentina, Austria, Belgium, Bulgaria, Chile, Czech Republic, France, Germany, Greece, Hungary, Israel, Italy, Kazakhstan, Netherlands, Portugal, Romania, Russia, South Africa, Spain and the UK, and Bifidus Essensis in the Middle East and formerly in Hungary, Bulgaria and The Netherlands through Activia from Safi Danone KSA. Hansen A/S from Denmark has a similar claim on a strain of 'Bifidobacterium animalis' subsp. 'lactis', mark...
*  KEGG PATHWAY: Homologous recombination - Bifidobacterium animalis subsp. animalis ATCC 25527
... Homologous recombination - Bifidobacterium animalis subsp. animalis ATCC 25527. [ Pathway menu Organism menu Pathway entry. Download KGML Show description User data mapping ]. Homologous recombination HR is essential for the accurate repair of DNA double-strand breaks DSBs, potentially lethal lesions. HR takes place in the late S-G2 phase of the cell cycle and involves the generation of a single-stranded region of DNA, followed by strand invasion, formation of a Holliday junction, DNA synthesis using the intact strand as a template, branch migration and resolution. It is investigated that RecA/Rad51 family proteins play a central role. The breast cancer susceptibility protein Brca2 and the RecQ helicase BLM Bloom syndrome mutated are tumor suppressors that maintain genome integrity, at least in part, through HR....
*  Animalis | ®
Animalis. The shrine of knowledge. Animalis Animalia definition at, a free online dictionary with pronunciation, synonyms and translation. Animalis is described in multiple online sources, as addition to our editors' articles, see section below for printable documents, Animalis books and related discussion. Suggested Pdf Resources Survival of Bifidobacterium animalis DN-173 010, the probiotic strain. Bifidobacterium animalis strain DN-173 010 shortens the colonic. Adaptation and Response of Bifidobacterium animalis subsp. lactis. animalis subsp. lactis IPLA 4549 and its targets of bile salt response and adaptation in B. Effects of synbiotic-based Bifidobacterium animalis in female rats. Mar 21, 2011 animalis and fructooligosaccharides on female rats infected with Toxoplasma Results suggest that the synbiotic composed of B. Bifidobacterium animalis Mitsuoka comb. Suggested News Resources Probiotics Useful in Preventing Necrotizing Enterocolitis in Preterm Infants. ...
*  Probiotic Bifidobacterium Bifidum Associated with Improved Irritable Bowel Symptoms | Valley Regiona
Probiotic Bifidobacterium Bifidum Associated with Improved Irritable Bowel Symptoms. Valley Regional Medical Center. Search Schedule. Patients & Visitors. Patients & Visitors Patients & Visitors. Notice of Privacy Practices. Medical Professionals. Medical Professionals Medical Professionals. Search Schedule. Patients & Visitors. Patients & Visitors Manage Account. Notice of Privacy Practices. Medical Professionals. Medical Professionals Physician Careers. Contact Us Maps Directions. Search Search service or treatment type. Valley Regional Medical Center. Valley Regional Medical Center treating Cardiac Arrhythmia with Atrial Fibrillation Ablation Procedure During Atrial Fibrillation Awareness month, Valley Regional Medical Center is educating the community on atrial fibrillation, or "AFib,” which is the most common type of arrhythmia. Valley Regional @valleymedcenter Understanding and Treating Atrial Fibrillation by James L. Valley Regional Medical Center as of today. Probiotic Bifidobacterium Bifidum Associat...
*  Intestinal bifidobacteria that produce trans-9, trans-11 conjugated linoleic acid: a fatty acid with
... antiproliferative activity against human colon SW480 and HT-29 cancer cells. Intestinal bifidobacteria that produce trans-9, trans-11 conjugated linoleic acid: a fatty acid with antiproliferative activity against human colon SW480 and HT-29 cancer cells. MedLine Citation:. Bifidobacterium breve species of human intestinal origin have the ability to synthesize cis-9, trans-11 c9, t11 conjugated linoleic acid CLA from free linoleic acid. In this study, the ability of Bifidobacterium species to isomerize C 18 polyunsaturated fatty acids was investigated, and the antiproliferative activities of the two main microbially produced CLA isomers were assessed. Linoleic acid was converted principally to c9, t11 CLA and lesser amounts of t9, t11 CLA, whereas c9, t11 CLA was converted mainly to t9, t11 CLA. Likewise, t10, c12 CLA was converted principally to t9, t11 CLA, which was incorporated into the bacterial cell membranes. To examine the antiproliferative effect of the two main CLA isomers formed, SW480 and HT-2...
*  Probiotics - Beyond Digestion
... Vitamins Supplements. Probiotics - Beyond Digestion. Harry Hirsute. Probiotics - Beyond Digestion. Quote: Data from a recent study demonstrate the anti-inflammatory and pathogen protection benefits of Bifidobacterium infantis 35624 a probiotic bacterial strain of human origin. The normal response to infection is rapid and effective, however, the immune response may occasionally cause inflammation and damage to healthy tissue. Past research has shown that the probiotic Bifidobacterium infantis 35624 can positively impact the body's immune defense, and this most recent data suggests that its benefits are not restricted to the gastrointestinal tract. The published study examined the effect of Bifidobacterium infantis 35624 administration on immunity to Salmonella Salmonella typhimurium, harmful bacteria that can cause intestinal infections and trigger the body's inflammatory response. Bifidobacterium infantis 35624, a probiotic strain isolated from healthy human gastrointestinal tissue, was administered to ...
*  Pfam: Proteome: Bifidobacterium longum (strain NCC 2705) (NCBI tax. ID 206672)
Pfam: Proteome: Bifidobacterium longum strain NCC 2705 NCBI tax. 1032 architectures. Proteome: Bifidobacterium longum strain NCC 2705 NCBI tax. This section gives details of the Pfam domains that are found on the completed proteome of Bifidobacterium longum strain NCC 2705. Number of sequences:. Number of domains:. The graphic that is shown by default represents a sequence containing that particular domain organisation or architecture. This example describes an architecture with one Gla domain, followed by two consecutive EGF domains, and finally a single Trypsin domain. a link to the page in the Pfam site showing information about the sequence that the graphic describes. the UniProt description of the protein sequence. the Pfam graphic itself. Finally, because some families can be found in a very large number of architectures, we load only the first fifty architectures by default. Loading domain graphics... This section shows the composition of this proteome, in terms of the Pfam domains which are found on i...
*  Proprietary Blend Bifidobacterium Lactis 1 Billion Cells
proprietary blend bifidobacterium lactis billion cells my account favorites help web vitamins live healthy look healthy free shipping over live chat since brand index a b c d e f g h i j k l m n o p q r s t u v w x y z all products vitamins supplements targeted formulas health personal care diet nutritional foods exercise teas accessories herbs children s products baby care homeopathy pet products more my favorites sign up for health news and exclusive discounts view all coupons your cart is empty full screen cart customer reviews featured brands nature s way country life thorne ortho molecular products jarrow formulas twinlab herbasway born free nutramedix now foods dr montague s brands proprietary blend bifidobacterium lactis billion cells products containing proprietary blend bifidobacterium lactis billion cells order by product name brand name lowest price highest price best rated most reviews off retail yumv s probiotic prebiotic fibers vanilla count servings shop by brand by category by nutrient about o...
*  Genome Atlas - 3.0 (beta)
Row Organism Tax Group NCBI Project ID Replicons Total Size bp % AT % Global Direct Repeats % Global Inverted Repeats % Local Direct Repeats % Local Inverted Repeats % Local Mirror Repeats % Local Everted Repeats % Simple Repeats. 4 Mycobacterium avium 104 BActin AA 88 1 5,475,491 31.0 9.30 5.10 14.40 10.00 8.70 8.00 1.10. 7 Mycobacterium avium subsp. 11 Clavibacter michiganensis subsp. 13 Leifsonia xyli subsp. 15 Mycobacterium tuberculosis H37Rv BActin AA 224 1 4,411,532 34.4 6.70 4.00 10.50 6.80 6.80 4.90 0.70. 18 Corynebacterium glutamicum ATCC 13032 BActin AA 307 1 3,309,401 46.2 3.30 2.70 4.70 3.30 2.40 1.60 0.40. 27 Corynebacterium glutamicum ATCC 13032 BActin AA 13760 1 3,282,708 46.2 3.10 2.80 4.70 3.30 2.40 1.60 0.40. 31 Mycobacterium tuberculosis F11 BActin AA 15642 1 4,424,435 34.4 6.80 4.00 10.50 6.80 6.90 4.90 0.70. 32 Mycobacterium abscessus ATCC 19977 BActin AA 15691 2 5,090,491 35.9 1.89 1.29 6.62 4.82 4.12 3.51 0.50. 35 Mycobacterium sp. 36 Mycobacterium sp. 37 Mycobacterium sp. 45 Mycobacter...
*  Biostart Paste for Animal Use -
... Natural Products. Veterinary Products. Vet. Biostart Paste. Biostart Paste. This page contains information on Biostart Paste for veterinary use. Biostart Paste. Beef Cattle Dairy Cattle Goats Horses Sheep Manufacturer: Bio-Vet Microbial/Vitamin Paste for Cattle, Sheep, Goats Horses. Saccharomyces cerevisiae, Lactobacillus acidophilus, Lactobacillus casei, Enterococcus faecium, Lactobacillus lactis, Pediococcus cerevisiae, Bacillus subtilis, Bacillus licheniformis, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium longum. Calcium carbonate, organic vegetable oil, active dry yeast, vitamin E supplement, dried Lactobacillus acidophilus fermentation product, dried Lactobacillus casei fermentation product, dried Enterococcus faecium fermentation product, dried Lactobacillus lactis fermentation product, dried Pediococcus cerevisiae fermentation product, vitamin A supplement, vitamin D3 supplement, ascorbic acid, calcium pantothenate, thiamine mononitrate, riboflavin, vitamin B12 supplement, py...
*  Calf GoldLyte for Animal Use -
... Natural Products. Veterinary Products. Vet. Calf GoldLyte. Calf GoldLyte. This page contains information on Calf GoldLyte for veterinary use. Calf GoldLyte. Beef Cattle Dairy Cattle Manufacturer: Bio-Vet Electrolyte/Microbial Supplement for Calves. Sodium min :. Lactobacillus acidophilus, Lactobacillus casei, Enterococcus faecium, Lactobacillus lactis, Pediococcus cerevisiae, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium longum. Dextrose, sodium chloride, potassium chloride, glycine, citric acid, sodium bicarbonate, inulin, primary dried yeast, monosodium phosphate, sodium silico aluminate, magnesium sulfate, dried kelp, ascorbic acid, thiamine mononitrate, riboflavin supplement, niacin supplement, calcium pantothenate, pyridoxine hydrochloride, folic acid, biotin, vitamin B12 supplement, dried Lactobacillus acidophilus fermentation product, dried Lactobacillus casei fermentation product, dried Enterococcus faecium fermentation product, dried Lactobacillus lactis fermentation product...
*  Max Body Supplements: Now Probiotic-10 25 Billion 50 Vcaps
... - Healthy Intestinal Flora* - 10 Probiotic Strains - Dairy, Wheat & Gluten Free - Vegetarian/Vegan Formula - A Dietary Supplement This NOW product is designed to provide a high potency and balanced spectrum of beneficial bacteria found in human intestinal tracts. This product also contains FOS to assist healthy growth of acidophilus and bifidus organisms.* Supplement Facts Serving Size 1 Vcap Servings Per Container 50 Amount Per Serving % Daily Value* Proprietary Blend of 10 Strains of Probiotic Bacteria: 25 Billion Organisms* Lactobacillus acidophilus, Bifidobacterium bifidum, Lactobacillus plantarum, Lactobacillus salivarious, Lactobacillus casei, Lactobacillus paracasei, Lactobacillus rhamnosus, Bifidobacterium breve, Bifidobacterium longum, Streptococcus thermophilus * Percent Daily Values are based on 2,000 calorie diet. - Healthy Intestinal Flora* - 10 Probiotic Strains - Dairy, Wheat & Gluten Free - Vegetarian/Vegan Formula - A Dietary Supplement This NOW product is designed to provide a high pote...
... Order History. BIODOPH-7 PLUS BIODOPH-7 PLUS by Biotics Research Each capsule contains a minimum of 20 billion gut-friendly probiotic organisms per capsule. BIODOPH-7 PLUS Supplement Facts Serving Size: 1 Capsule Proprietary Blend: 400 mg Inulin from chicory roof Arabinogalactans from Larch Marshmallow root extract Bifidobacterium bifidum Bifidobacterium lactis Bifidobacterium breve Lactobacillus paracasei Lactobacillus plantarum Lactobacillus salvarius Streptococcus thermophilus Other ingredients: Vegetarian capsule shell Each capsule of BioDoph-7 Plus contains more than 20 billion organisms per capsule at time of manufacture. CONTAINS: 60 Capsules Why you may need BioDoph-7 Plus: It is estimated that ~80% of the immune system is found in the gut, and the human body contains more bacteria living inside it than it has individual cells: 100 trillion microorganisms live in the gastrointestinal tract as compared with a mere 10 trillion human cells in the entire body. The majority of these bacterial strains ...
*  Soil Probitioc
Bacillus Laterosporus Bacillus Sphaericus Bacillus Subtilis Bifidus Bifidobacterium Bifidobacterium Bifidum Bifidobacterium Infantis Bifidobacterium Longum Bifidobacterium Animalis Bifidobacterium Breve Lactobacillus Lactobacillus Brevis Lactobacillus Bulgaricus Lactobacillus Casei Lactobacillus Helveticu s Lactobacillus Plantarum tarum Lactobacillus Reuteri Lactobacillus Rhamnosus Lactobacillus Sporogenes Lactobacillus Salvarius Saccharomyces Boulardii Saccharomyces Cerevisiae Streptococcus Thermophilus. Probiotics Research. Antibiotics Candida Enterococus Frozen Yogurt Soil Probiotic Yogurt Kefir Probiotic Supplement s Prebiotics Probiotics Side Effects Probiotics for Dogs Probiotics for Children Friendly Bacteria Intestinal Bacteria Intestinal Flora Probiotic Colonization Safety of Probiotics Soil Probiotic. Soil Probiotic INTRODUCTION Soil probiotics are commonly known as soil-based organisms SBOs. 3 In the same way that SBOs help eliminate harmful organisms in the soil, they reduce or prevent the growth ...
*  HLC Neonate 6g - Pharmax
... SHOP BY BRAND. SHOP BY CATEGORY. Adrenal Support Allergy Support Amino Acids Antioxidants Bone Health Cardiovascular Support Children's Formulas Daily Wellness Detoxification Support Digestive Support Essential Fatty Acids. Immune Support. Liver Support Memory Support Men's Health. Home > Shop by Brand > Pharmax > HLC Neonate 6g - Pharmax. Price: $23.75. HLC Neonate 6g is available by Pharmax. Contains Lactobacillus acidophilus, Lactobacillus casei and Bifidobacterium infantis. tract at birth, the neonate acquires microbial flora from the first day of life, and this flora is then responsible for a major part of the development of the entire infant immune system. Consequently, it is now seen as imperative that the infant has a competant composition of microflora from the first day of life and that this can be achieved by supplementation with probiotic organisms daily from birth. It contains the HLC strain of Lactobacillus acidophilus together with Lactobacillus paracasei which appears to be equally import...
*  Vetri-Science VetriProbiotic Everyday for Dogs - Compare Prices and Reviews on Vetri-Science VSLVET
... RIPROBIOTICEVERYDAY Vitamins Supplements at PriceGrabber. Vetri-Science VetriProbiotic Everyday for Dogs 60 Soft Chews - MPN: VSLVETRIPROBIOTICEVERYDAY Overview. Compare Prices. $17.94 - $29.98 Set Price Alert. Write a review. Fewer than 10 reviews Write a Review. Best Price $17.94 Tax: None Shipping: $4.95. On Sale Now Save 46%. See all-time ratings 7323 Reviews. $29.98 Tax: None Shipping: $9.99. 9313 Reviews. $18.29 Tax: None Shipping: Free. Free Shipping. Compare All 6 Stores. VETRI-PROBIOTIC EVERYDAY For Dogs 60 ct $16.50. Write a review. Write a review. Terry Naturally CuraMed Curcumin BCM-95 750 mg-60 Softgels. Write a review. 5 reviews. Terry Naturally CuraMed Curcumin BCM-95 750 mg-30 Softgels. Write a review. 1 Billion CFU Bacillus subtilis Bacillus coagulans Lactobacillus acidophilus Bifidobacterium thermophilum Bifidobacterium longum Lactobacillus fermentum Lactobacillus casei Bifidobacterium bifidum Enterococcus faecium Fructooligosaccharides FOS. 400 mgFeeding Directions: Give 1 soft chew dai... vetri-science-vetriprobiotic-everyday-for-dogs-60-soft-chews/m-761211974/?ut=6b15abe9effda2c4
*  HMF Forte 120c
... SHOP BY BRAND. Montiff Natural Health International Natural Ophthalmics Natural Vet Neutraceuticals Research Labs NewMark Nordic Naturals Nutri-Dyn Nutritional Biochemistry OL Medical. SHOP BY CATEGORY. Adrenal Support Allergy Support Amino Acids Antioxidants Bone Health Cardiovascular Support Children's Formulas Daily Wellness Detoxification Support Digestive Support Essential Fatty Acids. Immune Support. Joint Support Lipid Metabolism. Liver Support Memory Support Men's Health. Nutrition Bars Ocular Health Physical Fitness Respiratory Support Skin Support Sleep Relaxation Support Urinary Support Veterinary Vitamins Weight Control Women's Health. Thorne Research. Home > Shop by Brand > Seroyal/Genestra > HMF Forte 120c - Seroyal/Genestra. Price: $55.60. Manufacturer: Seroyal/Genestra. HMF Forte provides two strains of Lactobacillus acidophilus, Bifidobacterium bifidum and Bifidobacterium lactis, along with fructo-oligosaccharides to specifically assist in re-establishing and maintaining a normal intesti...
*  KEGG T00924: Balat 0300
... Bifidobacterium animalis subsp. lactis DSM 10140: Balat 0300. Entry Balat 0300 CDS T00924. Definition RefSeq succinyl-diaminopimelate desuccinylase. KO K01439. succinyl-diaminopimelate desuccinylase. Organism blt Bifidobacterium animalis subsp. lactis DSM 10140. Pathway blt00300. Lysine biosynthesis. blt01100. Metabolic pathways. blt01120. Microbial metabolism in diverse environments. blt01230. Biosynthesis of amino acids. Brite KEGG Orthology KO Metabolism Overview 01230 Biosynthesis of amino acids Balat 0300 Amino acid metabolism 00300 Lysine biosynthesis Balat 0300 Enzymes 3. Hydrolases 3.5 Acting on carbon-nitrogen bonds, other than peptide bonds 3.5.1 In linear amides succinyl-diaminopimelate desuccinylase Balat 0300. SSDB. Motif Pfam: Peptidase M20 M20 dimer Peptidase M28. Other DBs NCBI-ProteinID: ACS47256 NCBI-GI: 241195763 NCBI-GeneID: 8009922. Position 366798..368018. AA seq 406 aa. MQDVIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETHLTDMTEAFLRTLPHL DVQRHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEP...
*  KEGG T01841: BLC1 1375
Bifidobacterium animalis subsp. Organism bbc Bifidobacterium animalis subsp. Other glycan degradation. Sphingolipid metabolism. Brite KEGG Orthology KO Metabolism Lipid metabolism 00600 Sphingolipid metabolism BLC1 1375 Glycan biosynthesis and metabolism 00511 Other glycan degradation BLC1 1375 Enzymes 3. enzymes that hydrolyse O- and S-glycosyl compounds glucosylceramidase BLC1 1375. AA seq 484 aa. NT seq 1455 nt. +upstream nt +downstream nt atgattcaggcattctcaacatacgcgaatgcgcagggcaccacgcttgccgccgcgttc gcgccgcttgggaatgcctatttgcgtgtagggcgcacgccggagagcacgtcacacgcc agcacccccacgctcagcatcgacacgactcgcgtgcgccagcccatcgacggcttcggc gcatcgatcaccgaggcgacgagctggctgtggcacaatcgcgtcacagacaaagagcga tgcatccgcgatctgttcagcccgcgcgacggcataggcatctcgatgctccgtcagcca atcggcccaagcgaccatgtgagcgcgccgtaccgcttcgtgcgcagattccccgaccgc aatctcaactccctcgatttcacacccgagatggagcgcgtgttgcccatggtcgaggcc gcgaacgactgtgcgctcgccacgcaatcgcatgcgctcaacattatggcgagcccgtgg agcgcgccatggtggatgaaaacgaatctcagcgtgctcggcaaacggcgctacacgcgg atcaccggccatctgcggc...
*  Galactooligosaccharide
Chemistry Commercially available GOS Health benefits and issues Stimulating health-promoting bacteria. FODMAP and flatulence. Nissin is producing Cup-Oligo in syrup Cup-Oligo H70 and powder format Cup-Oligo P and Snow Brand produces GOS that is incorporated into its infant milk formula P7L, without offering sales outside its organization. In Europe, FrieslandCampina Domo is offering Vivinal GOS in a syrup format containing 57% oligosaccharides on dry matter and in a two powder format containing 29% or 71% oligosaccharides on dry matter. The Oligomate range is produced with enzymes originating from Aspergillus oryzae offering mainly β 1-6 linkages, the Bimuno product is produced using enzymes from a probiotic Bifidobacterium bifidum and contains mainly β 1-3 linkages whilst Cup-Oligo and Vivinal offer mainly β 1-4 linkages as a result of the activity of enzymes from Bacillus circulans for the latter and Cryptococcus laurentii for the former GOS product. Galacto-oligosaccharides GOS are classified as prebiotics...
*  Aviva Disease Resource | cranium bifidum
Aviva Disease Resource. cranium bifidum. Disease Resource Page for "cranium bifidum". *Genes are ranked by the number of publications which include both "cranium bifidum" and the gene. Gene Name. Uniprot. PubMed Link. All Publications. 2010 Publications. Aviva Product Pages. ABCB1. P08183. ABCB1 and cranium bifidum. 7 ABCB1 Antibody–In stock. ABCD3. P28288. ABCD3 and cranium bifidum. 1 ABCD3 Antibody–In stock. ABCG2. Q9UNQ0. ABCG2 and cranium bifidum. 2 ABCG2 Antibody–In stock. Acd. Q5EE38. Acd and cranium bifidum. 4 1 Acd Antibody–In stock. ACO2. Q99798. ACO2 and cranium bifidum. 1 ACO2 Antibody–In stock. ACP1. P24666. ACP1 and cranium bifidum. 1 ACP1 Antibody–In stock. ACTB. P60709. ACTB and cranium bifidum. 1 ACTB Antibody–In stock. ACTL7B. Q9Y614. ACTL7B and cranium bifidum. 1 ACTL7B Antibody–In stock. ACTN4. O43707. ACTN4 and cranium bifidum. 1 1 ACTN4 Antibody–In stock. ACVR2B. Q13705. ACVR2B and cranium bifidum. 1 ACVR2B Antibody–In stock. ACVRL1. P37023. ACVRL1 and cranium bifidum. 12. ACVRL1 Antibody...
ENZYME: Entry EC Enzyme. Name N-acetylhexosamine 1-kinase; NahK; LnpB; N-acetylgalactosamine/N-acetylglucosamine 1-kinase. Class Transferases; Transferring phosphorus-containing groups; Phosphotransferases with an alcohol group as acceptor. Sysname ATP:N-acetyl-D-hexosamine 1-phosphotransferase. Reaction IUBMB. ATP + N-acetyl-D-hexosamine = ADP + N-acetyl-alpha-D-hexosamine 1-phosphate. Reaction KEGG R08962 > R08967 R08968. Substrate ATP ; N-acetyl-D-hexosamine. Product ADP ; N-acetyl-alpha-D-hexosamine 1-phosphate. Comment This enzyme is involved in the lacto-N-biose I/galacto-N-biose degradation pathway in the probiotic bacterium Bifidobacterium longum. Differs from EC, N-acetylgalactosamine kinase, as it can phosphorylate both N-acetylgalactosamine and N-acetylglucosamine at similar rates. Also has some activity with N-acetyl-D-mannosamine, D-talose and D-mannose as substrate. ATP can be replaced by GTP or ITP but with decreased enzyme activity. Requires a divalent cation, wi...
*  Nature's Way - Primadophilus Bifidus 180 Capsules - Save 45%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Gas > Acidophilus View Larger Image Nature's Way (more from Nature's Way ) Primadophilus Bifidus 180 Capsules Item No. 40-15651 UPC: 033674156513 Retail Price: $41.99 Your Price: $22.99 Save: 45% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 90 C $12.99 Label Information Ingredients Reviews Once Daily for Healthy Digestive Flora True Potency 5 Billion CFU 4 Strain Formula Specifically Designed for Adults Suitable for Vegetarians True Identity Bifidobacteria & Lactobacilli True Release Targeted Delivery Enteric-Coated Exclusively backed by True Guarantee True Potency ensures 5 billion CFUs per capsule for the entire shelf life True Identity ensures only the strains listed on the label are found in the product True Release enteric-coating ensures stomach acid survival and intestinal delivery Vegetarian. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 180 Amount Per Ser... concerns/gas/acidophilus/natures way primadophilus bifidus 180 capsules.aspx
*  .. It all begins with research… .. The most effective ingredients… .. What Makes Nexabi
We could have gone with just the minimum doses but instead went with doses that are more than effective. Most of our competitors use low doses of probiotic that simply won’t be effective. Lactobacillus acidophilus :. Source 1. Lactobacillus bulgaricus :. It helps convert lactose to lactic acid which is helpful for those with lactose intolerance. Lactic acid bacteria can be found in fermented foods. Lactic acid bacteria also produce bacteriocins which help prevent the growth of pathogenic microorganisms. L helveticus is yet another lactic acid producer that is used in dairy production. L paracasei is found in naturally fermented products, yogurt, and natural dairy products like raw milk. L plantarum is also found in many fermented food products. Lactobacillus rhamnosus A :. Like other lactobacilli, Lactobacillus rhamnosus A  also releases acids, bacteriocins, and hydrogen peroxide which inhibit the growth of pathogens. B cogulans is a lactic acid-forming bacteria and is used in humans for improving the vagin...
*  Nature's Way - Primadophilus Bifidus 90 Capsules - Save 43%
... Order 1-800-338-7979 24-hrs. Category > Health Concerns > Skin Health > Acne View Larger Image. Nature's Way more from Nature's Way. Primadophilus Bifidus 90 Capsules Item No. 40-6860 UPC: 033674068601 Retail Price: $22.99 Your Price: $12.99 Save: 43% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 180 C $22.99. Label Information. Ingredients. Reviews. Once Daily for Healthy Digestive Flora True Potency 5 Billion CFU. For Adults True Identity Bifidobacteria & Lactobacilli True Release Targeted Delivery Enteric-Coated. True Potency ensures 5 billion CFUs per capsule for the entire shelf life. True Identity ensures only the strains listed on the label are found in the product. True Release enteric-coating ensures stomach acid survival and intestinal delivery. 4 strains formula specifically designed for adults. Suitable for Vegetarians. Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 30 Amount Per ... concerns/skin health/acne/natures way primadophilus bifidus 90 capsules.aspx
*  Nature's Way - Primadophilus Bifidus 90 Capsules - Save 43%
Order 1-800-338-7979 24-hrs. Category > Supplements > Probiotics > All Probiotics View Larger Image Nature's Way (more from Nature's Way ) Primadophilus Bifidus 90 Capsules Item No. 40-6860 UPC: 033674068601 Retail Price: $22.99 Your Price: $12.99 Save: 43% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 180 C $22.99 Label Information Ingredients Reviews Once Daily for Healthy Digestive Flora True Potency 5 Billion CFU For Adults True Identity Bifidobacteria & Lactobacilli True Release Targeted Delivery Enteric-Coated True Potency ensures 5 billion CFUs per capsule for the entire shelf life. True Identity ensures only the strains listed on the label are found in the product. True Release enteric-coating ensures stomach acid survival and intestinal delivery. 4 strains formula specifically designed for adults. Suitable for Vegetarians. Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 30 Amount Per Serving % ... way primadophilus bifidus 90 capsules.aspx
*  Nature's Way - Primadophilus Bifidus 180 Capsules - Save 45%
Order 1-800-338-7979 24-hrs. Brand > Nature's Way > Acidophilus / Probiotics / Digestion View Larger Image Nature's Way (more from Nature's Way ) Primadophilus Bifidus 180 Capsules Item No. 40-15651 UPC: 033674156513 Retail Price: $41.99 Your Price: $22.99 Save: 45% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 90 C $12.99 Label Information Ingredients Reviews Once Daily for Healthy Digestive Flora True Potency 5 Billion CFU 4 Strain Formula Specifically Designed for Adults Suitable for Vegetarians True Identity Bifidobacteria & Lactobacilli True Release Targeted Delivery Enteric-Coated Exclusively backed by True Guarantee True Potency ensures 5 billion CFUs per capsule for the entire shelf life True Identity ensures only the strains listed on the label are found in the product True Release enteric-coating ensures stomach acid survival and intestinal delivery Vegetarian. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 180 A... way/acidophilus probiotics digestion/natures way primadophilus bifidus 180 capsules.aspx
*  Nature's Way - Primadophilus Bifidus 180 Capsules - Save 45%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Constipation > Acidophilus View Larger Image Nature's Way (more from Nature's Way ) Primadophilus Bifidus 180 Capsules Item No. 40-15651 UPC: 033674156513 Retail Price: $41.99 Your Price: $22.99 Save: 45% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 90 C $12.99 Label Information Ingredients Reviews Once Daily for Healthy Digestive Flora True Potency 5 Billion CFU 4 Strain Formula Specifically Designed for Adults Suitable for Vegetarians True Identity Bifidobacteria & Lactobacilli True Release Targeted Delivery Enteric-Coated Exclusively backed by True Guarantee True Potency ensures 5 billion CFUs per capsule for the entire shelf life True Identity ensures only the strains listed on the label are found in the product True Release enteric-coating ensures stomach acid survival and intestinal delivery Vegetarian. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 180 Amoun... concerns/constipation/acidophilus/natures way primadophilus bifidus 180 capsules.aspx
*  Nature's Way - Primadophilus Bifidus 90 Capsules - Save 43%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Irritable Bowel > Acidophilus View Larger Image Nature's Way (more from Nature's Way ) Primadophilus Bifidus 90 Capsules Item No. 40-6860 UPC: 033674068601 Retail Price: $22.99 Your Price: $12.99 Save: 43% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 180 C $22.99 Label Information Ingredients Reviews Once Daily for Healthy Digestive Flora True Potency 5 Billion CFU For Adults True Identity Bifidobacteria & Lactobacilli True Release Targeted Delivery Enteric-Coated True Potency ensures 5 billion CFUs per capsule for the entire shelf life. True Identity ensures only the strains listed on the label are found in the product. True Release enteric-coating ensures stomach acid survival and intestinal delivery. 4 strains formula specifically designed for adults. Suitable for Vegetarians. Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 30 Amount Per Serv... concerns/irritable bowel/acidophilus/natures way primadophilus bifidus 90 capsules.aspx
*  Buy Essential Formulas Dr. Ohhira's Probiotics Professional Formula 120 Capsules and Save
Buy Essential Formulas Dr. Ohhira's Probiotics Professional Formula 120 Capsules and Save. Favorites. Help. Live Healthy. Look Healthy. Free Shipping over $49.*. All Products. Vitamins. Targeted Formulas. Health & Personal Care. Children's Products. My Favorites. Your cart is empty. Jarrow Formulas. NOW Foods. Dr. 695927121220 + Favorites. Targeted Formulas. Dr. Ohhira's Probiotics Professional Formula 120 Capsules by Essential Formulas 120 servings. Save 33% off retail Usually Ships in 2-3 Business Days Gluten Free Dairy Free Suitable for Vegetarians. Serving Size 1 Capsule, 120 servings per container Contains Proprietary Fermented Culture-fermented culture medium of fruit, vegetables, mushrooms and seaweeds containing prebiotics, enzymes, bacteriocins and trace amounts of vitamins, minerals and amino acids. Proprietary Organic Blend-citric acid, lactic acid, formic acid, acetic acid 1. Proprietary Lactic Acid Bacteria Blend 600 million CFU Mountain spring water, safflower oil, beeswax, lecithin, capsule...
*  KEGG T02092: BLIJ 2396
... Bifidobacterium longum subsp. infantis ATCC 15697 Tokyo : BLIJ 2396. Entry BLIJ 2396 CDS T02092. Definition RefSeq UDP-N-acetylglucosamine 1-carboxyvinyltransferase. KO K00790. UDP-N-acetylglucosamine 1-carboxyvinyltransferase. Organism blon Bifidobacterium longum subsp. infantis ATCC 15697 Tokyo. Pathway blon00520. Amino sugar and nucleotide sugar metabolism. blon00550. Peptidoglycan biosynthesis. blon01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00520 Amino sugar and nucleotide sugar metabolism BLIJ 2396 Glycan biosynthesis and metabolism 00550 Peptidoglycan biosynthesis BLIJ 2396 Enzymes 2. Transferases 2.5 Transferring alkyl or aryl groups, other than methyl groups 2.5.1 Transferring alkyl or aryl groups, other than methyl groups only sub-subclass identified to date UDP-N-acetylglucosamine 1-carboxyvinyltransferase BLIJ 2396. SSDB. Motif Pfam: EPSP synthase. Other DBs NCBI-ProteinID: BAJ69973 NCBI-GI: 384200400 NCBI-GeneID: 12166718. Position complement...
*  HMF Replete 7 Powder Sachets by Genestra | Rockwell Nutrition
HMF Replete 7 Powder Sachets by Genestra. Brands. Health Practitioner Brands. Other Brands. Home > Brands > Health Practitioner Brands > Genestra Brand Seroyal > Womens Health by Genestra > Genestra Pregnancy & Breast Feeding > Genestra Candida During Pregnancy. HMF Replete Probiotic by Genestra Intensive-level Probiotic Formula 150 billion CFU per sachet FOS Prebiotic included Ideal for vegans Convenient Sachet format. HMF Replete is a highly concentrated probiotic formula in sachets which provides strains of proprietary human-sourced Lactobacillus acidophilus, Lactobacillus salivarius, Bifidobacterium bifidum and Bifidobacterium animalis subsp. You must first start with a probiotic free of FOS such as HMF Intensive by Genestra. Allisyn Garlic by Genestra (60 caps) 60 caps $28.95 Add to Cart. HMF Neuro Powder 60g (FOS) by Genestra Powder 60g FOS $38.25 Add to Cart. HMF Forte Probiotic Capsules 60 caps by Genestra 60 caps $32.95 Add to Cart. HMF Intensive no FOS Probiotics Capsules by Genestra...
*  HMF Forte - Genestra
... Departments Men's Health Pet Health Women's Health Children's Health Immune Support Heart Health. Specialty Products Antioxidants Probiotics Green Drinks & More Herbs Specialty Formulas Fatty Acids Omega-3. Blood Sugar Balance Digestive/GI Health Memory Boost Hormone Support. Pure Prescriptions Top Sellers Pure Q10 Coenzyme Q10 Supports Heart Function and Cellular Energy. ...Advanced and unmatched Conenzyme Q10 formula that supports heart function and cellular energy + 600% more absorbable than other CoQ10!... Health A-Z Health Conditions Drug Interactions Vitamins Herbs. Health: Men/Women/Children Men's Health Women's Health Children's Health Aging Gracefully. Health Guides Vitamins & Herbs Diet Supplements Fitness Supplements Homeopathy Supplements A to Z Health Conditions Diabetes Allergies Health Tools Conditions A to Z Diet & Fitness Weight Loss Exercise Smart Eating RxAnswers Learn About Interactions Lipitor Zoloft Medicines A to Z. Ways to Save Health Packs Supersaver Pure Rewards On Sale VIP P...
*  Primal Defense Kids Probiotic Blend
... my account favorites help web vitamins live healthy look healthy free shipping over live chat since brand index a b c d e f g h i j k l m n o p q r s t u v w x y z all products vitamins supplements targeted formulas health personal care diet nutritional foods exercise teas accessories herbs children s products baby care homeopathy pet products more my favorites sign up for health news and exclusive discounts view all coupons your cart is empty full screen cart customer reviews featured brands nature s way country life thorne ortho molecular products jarrow formulas twinlab herbasway born free nutramedix now foods dr montague s brands primal defense kids probiotic blend the garden of life primal defense kids probiotic blend contains saccharomyces boulardii bifidobacterium longum bifidobacterium breve and bifidobacterium infantis products containing primal defense kids probiotic blend order by product name brand name lowest price highest price best rated most reviews off retail garden of life primal defens...
*  Buy Pharmax HLC MindLinx Powder 60 Grams and Save
... My Account. Favorites. Help. web vitamins. Live Healthy. Look Healthy. Free Shipping over $49.*. 1 800 919 9122 Live Chat. Since 1997 Brand Index :. A B. C. D. E. F. G. H. I. J. K. L. M. N O P. Q. R. S. T. U. V. W. X. Y. Z. All Products. Vitamins. Supplements. Targeted Formulas. Health & Personal Care. Diet, Nutritional Foods & Exercise. Teas & Accessories. Herbs. Children's Products. Baby Care. Homeopathy. Pet Products. More ... My Favorites. Sign up for health news and exclusive discounts. - View All Coupons -. Your cart is empty. - full-screen cart -. Customer Reviews. My Recent Items. Featured Brands Nature's Way. Country Life. Thorne. Ortho Molecular Products. Jarrow Formulas. Twinlab. Herbasway. Born Free. Nutramedix. NOW Foods. Dr. Montague's Brands. 883196201617 + Favorites. Vitamins & Supplements. Probiotics/Acidophilus. HLC MindLinx Powder 60 Grams by Pharmax 60 servings. $38.25. . Subscribe Save. Ships Free details with delivery every Months Days. Long-Term Backorder, Will Ship when Available ...
*  Bifidobacterium-lactobacillus - Side Effects, Dosage, Interactions | Everyday Health
Bifidobacterium-lactobacillus - Side Effects, Dosage, Interactions. Everyday Health. Drugs. Drugs A-Z. All Drugs. Log in. Log Out. Bifidobacterium-Lactobacillus. DRUGS. Side Effects. Everyday Health. Drugs. Bifidobacterium-lactobacillus. What Is Bifidobacterium-lactobacillus. Bifidobacterium and lactobacillus is a medical food used as a probiotic, or friendly bacteria to maintain a healthy digestive tract stomach and intestines. Not all uses for bifidobacterium and lactobacillus have been approved by the FDA. Bifidobacterium and lactobacillus should not be used in place of medication prescribed for you by your doctor. Do not use this product without medical advice. Tell each of your healthcare providers about all your medical conditions, allergies, and all medicines you use. Before using bifidobacterium and lactobacillus, talk to your healthcare provider. You may not be able to use bifidobacterium and lactobacillus if you have certain medical conditions. Bifidobacterium and lactobacillus is available in capsu...
*  Eden Foods Bifa-15 - 30 tubes per box
... GEO Free. Irradiation Free. BPA Free. Products. Organic Beans. Snacks, 4 oz. Organic Tomato Products. Organic Beans. Quick Overview A new formulation of Bifa-15, the effective probiotic food supplement with a seamless micro encapsulation delivery system for Bifidobacteria, the most important beneficial intestinal bacteria. Bifidobacteria combined with lactic acid producing bacteria and refreshing lemon flavored granules of oligosaccharides, increases the activity and the longevity of the Bifidobacteria. Details E den Bifa-15 is a probiotic food supplement to balance and strengthen utilizing a unique, technologically advanced delivery system to introduce friendly Bifidobacteria to the large intestine. Each tube of E den Bifa-15 contains orange bifidobacteria capsules, white lactobacillus capsules, and pleasantly flavored oligosaccharide granules that help bifidobacteria thrive. The capsules release bacteria only after reaching the large intestine - their natural 'home address.' Upon release lactobacillus ...
*  Eden Foods Bifa-15 - 3 tube pack
... GEO Free. Irradiation Free. BPA Free. Products. Organic Beans. Snacks, 4 oz. Organic Tomato Products. Organic Beans. Quick Overview A new formulation of Bifa-15, the effective probiotic food supplement with a seamless micro encapsulation delivery system for Bifidobacteria, the most important beneficial intestinal bacteria. Bifidobacteria combined with lactic acid producing bacteria and refreshing lemon flavored granules of oligosaccharides, increases the activity and the longevity of the Bifidobacteria. Details E den Bifa-15 is a probiotic food supplement to balance and strengthen utilizing a unique, technologically advanced delivery system to introduce friendly Bifidobacteria to the large intestine. Each tube of E den Bifa-15 contains orange bifidobacteria capsules, white lactobacillus capsules, and pleasantly flavored oligosaccharide granules that help bifidobacteria thrive. The capsules release bacteria only after reaching the large intestine - their natural 'home address.' Upon release lactobacillus ...
*  Life Start 2 Goat Milk Powder 2.5 oz Natren Natren - Compare Price and Reviews at
FREE US ground shipping on orders over $100, and flat rate $6.99 on orders under $100. Natren Life Start 2 - Goat Milk Powder Specially formulated for people with digestive problems of irregularity and occasional constipation and diarrhea. Thousands of mothers and infants have enjoyed the benefits of the original Life Start. Recent research has proven the same bacteria found in Life Start and Life Start 2, Bifidobacterium infantis, has major benefits for all ages, especially people with abdominal discomfort. Life Start 2 is available in powder and capsule formulas. Life Start 2 probiotic formula is specifically designed and formulated for children, adolescents and adults with immune system hypersensitivity that leads to occasional diarrhea, minor constipation, gas and bloating. Buy 5, receive FREE shipping on this item. Life Start 2, Goat Milk Powder, 2.5 oz, NatrenNatren Life Start 2 - Goat Milk Powder Specially formulated for people with digestive problems of irregularity and occasional constipation and dia...
*  Natural Factors - Ultimate Probiotic Women's Formula 60 Capsules - Save 29%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Gluten Intolerance > Digestion > Probiotics & Acidophilus > All Probiotics View Larger Image Natural Factors (more from Natural Factors ) Ultimate Probiotic Women's Formula 60 Capsules Item No. G3-01849 UPC: 068958018492 Retail Price: $29.95 Your Price: $20.97 Save: 29% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Label Information Ingredients Reviews Ultimate Probiotic Women's Formula Dr. Michael Murray Formulated Supports Intestinal & Urinary Tract Health* With Cranberry Concentrate Dr. Murray's Ultimate Probiotic, specially formulated for women, contains a proprietary blend of only the most potent bacteria strains that work synergistically guaranteeing maximum activity.* The formula contains CranRich to support urinary tract health.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value Proprietary Synergistic Blend: Total Active Ce... concerns/gluten intolerance/digestion/probiotics acidophilus/all probiotics/natural factors ultimate probiotic womens formula 60 capsules.aspx
*  Natural Factors - Ultimate Probiotic Women's Formula 60 Capsules - Save 29%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Gluten Intolerance > Digestion > Probiotics & Acidophilus > All Probiotics View Larger Image Natural Factors (more from Natural Factors ) Ultimate Probiotic Women's Formula 60 Capsules Item No. G3-01849 UPC: 068958018492 Retail Price: $29.95 Your Price: $20.97 Save: 29% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Label Information Ingredients Reviews Ultimate Probiotic Women's Formula Dr. Michael Murray Formulated Supports Intestinal & Urinary Tract Health* With Cranberry Concentrate Dr. Murray's Ultimate Probiotic, specially formulated for women, contains a proprietary blend of only the most potent bacteria strains that work synergistically guaranteeing maximum activity.* The formula contains CranRich to support urinary tract health.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value Proprietary Synergistic Blend: Total Active Ce... factors ultimate probiotic womens formula 60 capsules.aspx
*  Topical Probiotic Spray for Dogs and Cats
... Urinary Incontinence. *The Pet Health and Nutrition Center. Ingredients: Purified and Structured Water, Organic Sugarcane Molasses, Probiotic Lactic Acid Cultures, Mineral Powder, Sea Salt, Organic Cherry Juice Concentrate, Organic Blueberry Juice Concentrate, Organic Pomegranate Juice Concentrate, Brown Rice Liquid Extract Species: Bifidobacterium animalis Bifidobacterium bifidum Bacillus subtilis Bifidobacterium longum Lactobacillus acidophilus Lactobacillus bulgaricus Lactobacillus casei Lactobacillus delbrueckii Lactobacillus fermentum Lactobacillus plantarum Lactococcus lactis Lactococcus lactis subsp. Urinary Tract Infections Spray vagina, or head of penis on male dogs, four times per day to help eliminate urinary tract infections or twice daily for prevention of future infections. Incontinence An effective cleanser for urinary or fecal incontinence issues to prevent bacterial infection on skin or to prevent urinary tract infections which are often caused by E. Our Female Daily Vitality Blend is th...
*  Proflora® Probiotic Soft Chews (60 Count)
Proflora Probiotic Soft Chews 60 Count. Dog Food. Cat Food. View All. View All. Proflora veterinary-strength probiotic soft chews for dogs help support digestion and overall canine health. Soft Chews Your Dog Will Love Proflora Probotic Soft Chews are a tasty natural chicken flavor that your dog will love eating and they will in turn help support your dog's digestive system health and function. More Info Pet Health Solutions Browse more products from Pet Health Solutions. Digestive Health Supplements Check out some of the top digestive health supplements. Ingredients: Brewers Dried Yeast, Natural Chicken Flavor, Glycerin, Fructooligosaccharides, Yeast Extract, Canola Oil, Lecithin, Dried Bacillus Subtilis Fermentation Product, Dried Lactobacillus Casei Fermentation Product, Dried Lactobacillus Fermentum Fermentation Product, Dried Bifidobacterium Bifidum Fermentation Product, Maltodextrin, Sodium Alginate, Calcium Sulfate, Dried Lactobacillus Acidophilus Fermentation Product, Dried Bifidobacterium Longum Ferm...
*  Probiotic Protection | The Scientist Magazine®
Probiotic Protection. The Scientist Magazine. The Scientist Sign In or Register. Advertisement. The Scientist. Magazine. The Literature. Probiotic Protection Editor s choice in microbiology By Richard P. Grant. July 1, 2011. SCIMAT / PHOTO RESEARCHERS, INC The paper S. Fukuda et al., Bifidobacteria can protect from enteropathogenic infection through production of acetate, Nature, 469:543-47, 2011. Free F1000 evaluation The finding When Hiroshi Ohno s colleague at RIKEN noticed that some strains of bacteria could protect mice from otherwise lethal infections with the pathogenic E. coli O157:H7 called O157, Ohno decided to find out why. He found that the protective bacteria expresses a transporter protein that allows it to produce acetate, which inhibits the infected host cell s uptake of Shiga toxin responsible for the bloody diarrhea and colitis caused by the 0157 strain. The observation Germ-free mice infected with either O157 alone, or O157 together with a strain of Bifidobacterium adolescentis that natural...
*  Contraindications for Adult 50+ Probiotic oral
... Health A-Z. Diabetes. Featured Topics. See what your medical symptoms could mean, and learn about possible conditions. Second Opinion: Read expert perspectives on popular health topics. Communities: Connect with people like you, and get expert guidance on living a healthy life. WebMD Pain Coach. Drugs Supplements. Find Information About:. Drugs Supplements. Get information and reviews on prescription drugs, over-the-counter medications, vitamins, and supplements. Find or Review a Drug. Find or Review a Vitamin or Supplement. Taking Medications During Pregnancy. WebMD My Medicine Save your medicine, check interactions, sign up for FDA alerts, create family profiles and more. Drug News. Get the Latest Drug Approvals Alerts. Find FDA Consumer Updates. Sign up to receive WebMD's award-winning content delivered to your inbox. WebMD Mobile Drug Information App. Drug, supplement, and vitamin information on the go. Living Healthy. Featured Content. Diet, Food Fitness. Women's Health. Featured Topics. Family Preg...
*  Contraindications for Adult 50+ Probiotic oral
... Health A-Z. Diabetes. Featured Topics. See what your medical symptoms could mean, and learn about possible conditions. Second Opinion: Read expert perspectives on popular health topics. Communities: Connect with people like you, and get expert guidance on living a healthy life. WebMD Pain Coach. Drugs Supplements. Find Information About:. Drugs Supplements. Get information and reviews on prescription drugs, over-the-counter medications, vitamins, and supplements. Find or Review a Drug. Find or Review a Vitamin or Supplement. Taking Medications During Pregnancy. WebMD My Medicine Save your medicine, check interactions, sign up for FDA alerts, create family profiles and more. Drug News. Get the Latest Drug Approvals Alerts. Find FDA Consumer Updates. Sign up to receive WebMD's award-winning content delivered to your inbox. WebMD Mobile Drug Information App. Drug, supplement, and vitamin information on the go. Living Healthy. Featured Content. Diet, Food Fitness. Women's Health. Featured Topics. Family Preg...
*  KEGG T01143: BDP 0551
... Bifidobacterium dentium: BDP 0551. Entry BDP 0551 CDS T01143. Gene name folP. Definition RefSeq dihydropteroate synthase EC: KO K00796. dihydropteroate synthase. Organism bde Bifidobacterium dentium. Pathway bde00790. Folate biosynthesis. bde01100. Metabolic pathways. Module bde M00126. Tetrahydrofolate biosynthesis, GTP => THF. Brite KEGG Orthology KO Metabolism Metabolism of cofactors and vitamins 00790 Folate biosynthesis BDP 0551 folP Enzymes 2. Transferases 2.5 Transferring alkyl or aryl groups, other than methyl groups 2.5.1 Transferring alkyl or aryl groups, other than methyl groups only sub-subclass identified to date dihydropteroate synthase BDP 0551 folP. SSDB. Motif Pfam: Pterin bind. AA seq 292 aa. NT seq 879 nt. +upstream nt +downstream nt atggtggcacaggatatgaaggcgattcacgatagcgaacgcaccctggtgatgggcgtg ctcaacatcaccgaagactcgttctcagacggtggattgtggctcgatccggcaaaggcc aaggcacacggcgaggcgatgatgaaggatggggccgacatcatcgacatcggagccgaa tccacccggcccggcgccaagcgcgtcagcgaggaagacgagaaatcccgcgtgc...
*  KEGG T01419: BLLJ 1402
... Bifidobacterium longum subsp. longum JCM 1217: BLLJ 1402. Entry BLLJ 1402 CDS T01419. Definition RefSeq glucokinase. KO K00886. polyphosphate glucokinase. Organism blm Bifidobacterium longum subsp. longum JCM 1217. Pathway blm00010. Glycolysis / Gluconeogenesis. blm00520. Amino sugar and nucleotide sugar metabolism. blm01100. Metabolic pathways. blm01110. Biosynthesis of secondary metabolites. blm01120. Microbial metabolism in diverse environments. blm01130. Biosynthesis of antibiotics. blm01200. Carbon metabolism. Module blm M00549. Nucleotide sugar biosynthesis, glucose => UDP-glucose. Brite KEGG Orthology KO Metabolism Overview 01200 Carbon metabolism BLLJ 1402 Carbohydrate metabolism 00010 Glycolysis / Gluconeogenesis BLLJ 1402 00520 Amino sugar and nucleotide sugar metabolism BLLJ 1402 Enzymes 2. Transferases 2.7 Transferring phosphorus-containing groups 2.7.1 Phosphotransferases with an alcohol group as acceptor polyphosphate---glucose phosphotransferase BLLJ 1402. SSDB. Motif Pfam: ROK. O...
*  ppc - Phosphoenolpyruvate carboxylase - Bifidobacterium longum subsp. longum KACC 91563
/p> p> a href='../manual/annotation score' target=' top'>More... /p> p> a href='../manual/function section' target=' top'>More... /p> p> a href="/manual/evidences#ECO:0000256">More… /a> /p> Automatic assertion according to rules i SAAS:SAAS00217070. /p> p> a href="/manual/evidences#ECO:0000256">More… /a> /p> Automatic assertion according to rules i SAAS:SAAS00018766. /p> p> a href='../manual/cofactor' target=' top'>More... /p> p> a href="/manual/evidences#ECO:0000256">More… /a> /p> Automatic assertion according to rules i SAAS:SAAS00167156. /p> p> a href="/manual/evidences#ECO:0000256">More… /a> /p> Automatic assertion according to rules i SAAS:SAAS00018762 p>UniProtKB Keywords constitute a a target=" top" href="/keywords">controlled vocabulary /a> with a hierarchical structure. /p> p> a href="/manual/evidences#ECO:0000256">More… /a> /p> Automatic assertion according to rules i SAAS:SAAS00018768 p>UniProtKB Keywor...
*  Blon 0412 - Non-canonical purine NTP pyrophosphatase - Bifidobacterium longum subsp. infantis (strai
/p> p> a href='../manual/annotation score' target=' top'>More... /p> p> a href='../manual/protein existence' target=' top'>More... /p> p> a href='../manual/function section' target=' top'>More... /p> p> a href="/manual/evidences#ECO:0000255">More… /a> /p> Manual assertion according to rules i HAMAP-Rule:MF 01405. /p> p> a href='../manual/cofactor' target=' top'>More... /p> p> a href="/manual/evidences#ECO:0000255">More… /a> /p> Manual assertion according to rules i HAMAP-Rule:MF 01405, Mn 2+ UniRule annotation. /p> p> a href="/manual/evidences#ECO:0000255">More… /a> /p> Manual assertion according to rules i HAMAP-Rule:MF 01405. /p> p> a href="/manual/evidences#ECO:0000255">More… /a> /p> Manual assertion according to rules i HAMAP-Rule:MF 01405. /p> p> a href="/manual/evidences#ECO:0000255">More… /a> /p> Manual assertion according to rules i HAMAP-Rule:MF 01405. /p> p> a href="/manual/evidences#ECO:0000255">Mo...
*  .. Monthly Archives: February 2011 .. Antioxidants: hype or… hazard? .. Smells like t
24 February 2011. Biology, Medicine. Chris. Continue reading Antioxidants: hype or… hazard. Leave a comment. 24 February 2011. Biology. Chris. Continue reading Smells like teen romance →. Leave a comment. 24 February 2011. Biology. Chris. Leave a comment. 23 February 2011. Geology. Chris. Image by USGS, via Wikimedia Commons. Continue reading Seismology of the Christchurch earthquake →. Leave a comment. Ashes to ashes. 17 February 2011. Chris. Scanning electronic micrography of bone mineral at 10000x magnification Image by User:Sbertazzo, via Wikimedia Commons There isn’t a lot of tricalcium phosphate left in cremated human remains or “cremains”, if you prefer, only about 3.5% of the body’s original mass. And it isn’t really harmful to the environment; if anything, calcium phosphate makes a good fertiliser. Continue reading Ashes to ashes →. 17 February 2011. Chris. First of all, a NASA astrobiologist, Felisa Wolfe-Simon, and her team found some bacteria in Lake Mono, in California. Felisa Wolfe-Simon process...
*  Intestinal bacteria produce neurotransmitter, could play role in inflammation
... India Healthcare. Latest Research. Medical News. Latest Research Channel. subscribe to Latest Research newsletter. Latest Research. Intestinal bacteria produce neurotransmitter, could play role in inflammation. The next step, says Pokusaeva is to conduct in vitro experiments to determine if the increased GABAA expression correlates with a decrease in production of cytokines associated with inflammation. GABAA receptor signaling may also contribute to pain signaling in the gut and may somehow be involved in abdominal pain disorders. It plays a role in regulating pain and some pain relieving drugs currently on the market act by targeting GABA receptors on neural cells. Pokusaeva and her colleagues were interested in understanding the role the human microbiome might play in pain and scanned the genomes of potentially beneficial intestinal microorganisms, identified by the Human Microbiome Project, for evidence of a gene that would allow them to create GABA. dentium could have an effect on GABA receptors pre...
*  Lindberg - Probiotic 8 Billion 120 Capsules - Save 58%
... Order 1-800-338-7979 24-hrs. Home Page > Top Nav > Supplements > Tabs > Probiotics View Larger Image. Lindberg more from Lindberg. Probiotic 8 Billion 120 Capsules Item No. 99-81 UPC: 092865000813 Retail Price: $45.99 Your Price: $18.99 Save: 58% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 60 C $9.99. Label Information. Ingredients. Reviews. Related Articles. Probiotic 8 Billion Supports Immune Health and Intestinal Function*. Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 120 Amount Per Serving % Daily Value. Probiotic 3-Strain Blend 8 Billion CFU**. * Lactobacillus Acidophilus 4 Billion CFU. * Bifidobacterium Lactis 3.2 Billion CFU. * Bifid... page/top nav/supplements/tabs/probiotics/lindberg probiotic 8 billion 120 capsules.aspx
*  Lindberg - Probiotic 8 Billion 60 Capsules - Save 58%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Constipation View Larger Image Lindberg (more from Lindberg ) Probiotic 8 Billion 60 Capsules Item No. 99-80 UPC: 092865000806 Retail Price: $23.99 Your Price: $9.99 Save: 58% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 120 C $18.99 Label Information Ingredients Reviews Related Articles Probiotic 8 Billion Supports Immune Health and Intestinal Function* Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value Probiotic 3-Strain Blend (8 Billion CFU**) * Lactobacillus Acidophilus (4 Billion CFU) * Bifidobacterium Lactis (3.2 Billion CFU) * Bifidobacterium Longum (0.8 Bil... concerns/constipation/lindberg probiotic 8 billion 60 capsules.aspx
*  Lindberg - Probiotic 8 Billion 60 Capsules - Save 58%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Lactose Intolerance View Larger Image Lindberg (more from Lindberg ) Probiotic 8 Billion 60 Capsules Item No. 99-80 UPC: 092865000806 Retail Price: $23.99 Your Price: $9.99 Save: 58% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 120 C $18.99 Label Information Ingredients Reviews Related Articles Probiotic 8 Billion Supports Immune Health and Intestinal Function* Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value Probiotic 3-Strain Blend (8 Billion CFU**) * Lactobacillus Acidophilus (4 Billion CFU) * Bifidobacterium Lactis (3.2 Billion CFU) * Bifidobacterium Longum (... concerns/lactose intolerance/lindberg probiotic 8 billion 60 capsules.aspx
*  Lindberg - Probiotic 8 Billion 60 Capsules - Save 58%
Order 1-800-338-7979 24-hrs. Category > Supplements View Larger Image Lindberg (more from Lindberg ) Probiotic 8 Billion 60 Capsules Item No. 99-80 UPC: 092865000806 Retail Price: $23.99 Your Price: $9.99 Save: 58% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 120 C $18.99 Label Information Ingredients Reviews Related Articles Probiotic 8 Billion Supports Immune Health and Intestinal Function* Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value Probiotic 3-Strain Blend (8 Billion CFU**) * Lactobacillus Acidophilus (4 Billion CFU) * Bifidobacterium Lactis (3.2 Billion CFU) * Bifidobacterium Longum (0.8 Billion CFU) * * Daily... probiotic 8 billion 60 capsules.aspx
*  Lindberg - Probiotic 8 Billion 120 Capsules - Save 58%
... Order 1-800-338-7979 24-hrs. Category > Health Concerns > Candida Yeast View Larger Image. Lindberg more from Lindberg. Probiotic 8 Billion 120 Capsules Item No. 99-81 UPC: 092865000813 Retail Price: $45.99 Your Price: $18.99 Save: 58% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 60 C $9.99. Label Information. Ingredients. Reviews. Related Articles. Probiotic 8 Billion Supports Immune Health and Intestinal Function*. Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 120 Amount Per Serving % Daily Value. Probiotic 3-Strain Blend 8 Billion CFU**. * Lactobacillus Acidophilus 4 Billion CFU. * Bifidobacterium Lactis 3.2 Billion CFU. * Bifidobacterium ... concerns/candida yeast/lindberg probiotic 8 billion 120 capsules.aspx
*  Lindberg - Probiotic 8 Billion 60 Capsules - Save 58%
... Order 1-800-338-7979 24-hrs. Category > Health Concerns > Yeast Candida View Larger Image. Lindberg more from Lindberg. Probiotic 8 Billion 60 Capsules Item No. 99-80 UPC: 092865000806 Retail Price: $23.99 Your Price: $9.99 Save: 58% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 120 C $18.99. Label Information. Ingredients. Reviews. Related Articles. Probiotic 8 Billion Supports Immune Health and Intestinal Function*. Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value. Probiotic 3-Strain Blend 8 Billion CFU**. * Lactobacillus Acidophilus 4 Billion CFU. * Bifidobacterium Lactis 3.2 Billion CFU. * Bifidobacterium L... concerns/yeast candida/lindberg probiotic 8 billion 60 capsules.aspx
*  Lindberg - Probiotic 8 Billion 60 Capsules - Save 58%
... Order 1-800-338-7979 24-hrs. Category > Health Concerns > Intestinal Cleansers View Larger Image. Lindberg more from Lindberg. Probiotic 8 Billion 60 Capsules Item No. 99-80 UPC: 092865000806 Retail Price: $23.99 Your Price: $9.99 Save: 58% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 120 C $18.99. Label Information. Ingredients. Reviews. Related Articles. Probiotic 8 Billion Supports Immune Health and Intestinal Function*. Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value. Probiotic 3-Strain Blend 8 Billion CFU**. * Lactobacillus Acidophilus 4 Billion CFU. * Bifidobacterium Lactis 3.2 Billion CFU. * Bifidobact... concerns/intestinal cleansers/lindberg probiotic 8 billion 60 capsules.aspx
*  Lindberg - Probiotic 8 Billion 120 Capsules - Save 58%
Order 1-800-338-7979 24-hrs. Home Page > SitePolicy View Larger Image Lindberg (more from Lindberg ) Probiotic 8 Billion 120 Capsules Item No. 99-81 UPC: 092865000813 Retail Price: $45.99 Your Price: $18.99 Save: 58% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 60 C $9.99 Label Information Ingredients Reviews Related Articles Probiotic 8 Billion Supports Immune Health and Intestinal Function* Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 120 Amount Per Serving % Daily Value Probiotic 3-Strain Blend (8 Billion CFU**) * Lactobacillus Acidophilus (4 Billion CFU) * Bifidobacterium Lactis (3.2 Billion CFU) * Bifidobacterium Longum (0.8 Billion CFU) * * Dail... page/sitepolicy/lindberg probiotic 8 billion 120 capsules.aspx
*  Lindberg - Probiotic 8 Billion 60 Capsules - Save 58%
... Order 1-800-338-7979 24-hrs. Category > Specials & Hot Deals > Weekly Deals View Larger Image. Lindberg more from Lindberg. Probiotic 8 Billion 60 Capsules Item No. 99-80 UPC: 092865000806 Retail Price: $23.99 Your Price: $9.99 Save: 58% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 120 C $18.99. Label Information. Ingredients. Reviews. Related Articles. Probiotic 8 Billion Supports Immune Health and Intestinal Function*. Lindberg Probiotic 8 Billion contains three major strains of probiotics found in the body. These three strains help restore the body’s “friendly” bacteria, help crowd out “unfriendly” bacteria and yeast, and help support immune health and intestinal function.* Vegetarian Capsules. Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 60 Amount Per Serving % Daily Value. Probiotic 3-Strain Blend 8 Billion CFU**. * Lactobacillus Acidophilus 4 Billion CFU. * Bifidobacterium Lactis 3.2 Billion CFU. * Bifidobacteri... hot deals/weekly deals/lindberg probiotic 8 billion 60 capsules.aspx
*  Dr Sinatra - Search Results for Gut
... Dr. Stephen Sinatra View Cart 0. View Cart Check Out. Search. Menu. Search. Shop Vitamins & Supplements. Shop By Health Interest A to Z Index. Blood Sugar. Digestive Health. General Health. Heart Health. Immune Health. Healthy Food Drink. New Products. Omega-3 Supplements. Omega-Q Plus Supplements. CoQ10 Supplements. Probiotics. CoQ10. Omega-3. Probiotics. Seanol. Top Sellers Omega Q Plus. Heart Healthy Multivitamins. Seanol Longevity Plus/Seanol. Best Sellers. Special Offers Clearance. Get 2 FREE Bottles. Products under $20. View Health A-Z. Health Advice CoQ10. Omega-3s. General Health. Blood Sugar. Digestive Health. Heart Health. Immune Health. Dr. Sinatra's Newsletters. Sinatra. About Dr. Sinatra. Heart Healthy Probiotic Solutions Colon Health Item## PCI $29.99 immune support—two things we need more of as we age. Lactobacillus and Bifidobacteria are the most prevalent and beneficial bacteria found in your gut. Lactobacilli make up the majority of the bacteria in your small intestine, while Bifidobact...
*  Dr Sinatra - Search Results for Gut
... Dr. Stephen Sinatra View Cart 0. View Cart Check Out. Search. Menu. Search. Shop Vitamins & Supplements. Shop By Health Interest A to Z Index. Blood Sugar. Digestive Health. General Health. Heart Health. Immune Health. Healthy Food Drink. New Products. Omega-3 Supplements. Omega-Q Plus Supplements. CoQ10 Supplements. Probiotics. CoQ10. Omega-3. Probiotics. Seanol. Top Sellers Omega Q Plus. Heart Healthy Multivitamins. Seanol Longevity Plus/Seanol. Best Sellers. Special Offers Clearance. Get 2 FREE Bottles. Products under $20. View Health A-Z. Health Advice CoQ10. Omega-3s. General Health. Blood Sugar. Digestive Health. Heart Health. Immune Health. Dr. Sinatra's Newsletters. Sinatra. About Dr. Sinatra. Heart Healthy Probiotic Solutions Colon Health Item## PCI $29.99 immune support—two things we need more of as we age. Lactobacillus and Bifidobacteria are the most prevalent and beneficial bacteria found in your gut. Lactobacilli make up the majority of the bacteria in your small intestine, while Bifidobact...
*  Dr Sinatra - Search Results for Gut
... Dr. Stephen Sinatra View Cart 0. View Cart Check Out. Search. Menu. Search. Shop Vitamins & Supplements. Shop By Health Interest A to Z Index. Blood Sugar. Digestive Health. General Health. Heart Health. Immune Health. Healthy Food Drink. New Products. Omega-3 Supplements. Omega-Q Plus Supplements. CoQ10 Supplements. Probiotics. CoQ10. Omega-3. Probiotics. Seanol. Top Sellers Omega Q Plus. Heart Healthy Multivitamins. Seanol Longevity Plus/Seanol. Best Sellers. Special Offers Clearance. Get 2 FREE Bottles. Products under $20. View Health A-Z. Health Advice CoQ10. Omega-3s. General Health. Blood Sugar. Digestive Health. Heart Health. Immune Health. Dr. Sinatra's Newsletters. Sinatra. About Dr. Sinatra. Heart Healthy Probiotic Solutions Colon Health Item## PCI $29.99 immune support—two things we need more of as we age. Lactobacillus and Bifidobacteria are the most prevalent and beneficial bacteria found in your gut. Lactobacilli make up the majority of the bacteria in your small intestine, while Bifidobact... a:type:articles
*  DJO Global Brands & Products | DJO Global
DJO Global Brands & Products. DJO Global. International. Europe Australia Belgium Dutch Belgium French Canada English Canada French China Danmark Finland France Germany Ireland Italy Luxemburg Nederland Norway South Africa Spain Sweden United Kingdom. Search form. Search this site. DJO Global. Brands Products. Aircast DJO Surgical Fast Freeze Bell-Horn Dr. Comfort ProCare Chattanooga DonJoy Saunders CMF DonJoy Performance Empi DVT Compex Exos VitalStim. DJO Healthcare Services. Education. Videos Patient Education Medical Education. Contacts by Brand Worldwide Contacts Sales Rep Locator Order Tracking. US Opportunities International Opportunities Distributor Partner Opportunities More. Compliance. DJO Global. Home DJO Global Brands Products. Search this site. DJO Global Brands Products. Aircast set a new standard of care for injuries with patented technology. Learn More. View Aircast Products. Learn More. View Bell-Horn Products. Learn More. View Chattanooga Products. CMF technology provides medical profession...
*  Wakunaga (Kyolic) - Kyo-Dophilus 90 Capsules - Save 39%
Wakunaga Kyolic - Kyo-Dophilus 90 Capsules - Save 39%. Order 1-800-338-7979 24-hrs. Category > Health Concerns > Skin Health > Acne View Larger Image. Wakunaga Kyolic more from Wakunaga Kyolic. Kyo-Dophilus 90 Capsules Item No. 51-538-421 UPC: 023542600491 Retail Price: $20.45 Your Price: $12.45 Save: 39% OFF. Quantity:. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20. Add to Cart. In stock. Other sizes 180 C $20.95. Label Information. Ingredients. Reviews. Kyo-Dophilus. Probiotic Supplement. Digestion & Immune Health* Promotes Healthy Intestinal Function* Restore -- Balance -- Protect Probiotic Supplement Dairy Free. Kyo-Dophilus is formulated with three specially cultured, non-dairy, heat-stable, stomach acid resistant human strains of beneficial bacteria. This Friendly Trio gives you relief from the inconvenience caused by bad bacteria. Take Kyo-Dophilus during and after a cycle of medication, when you travel, and every day to boost immunity, promote healthy intestinal function and general well-being. I... concerns/skin health/acne/wakunaga kyolic kyo-dophilus 90 capsules.aspx
*  Wakunaga (Kyolic) - Kyo-Dophilus 180 Capsules - Save 38%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Women's Health > Yeast Infection > Acidophilus View Larger Image Wakunaga (Kyolic) (more from Wakunaga (Kyolic) ) Kyo-Dophilus 180 Capsules Item No. 51-538-934 UPC: 023542600422 Retail Price: $33.95 Your Price: $20.95 Save: 38% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 90 C $12.45 Label Information Ingredients Reviews Digestion & Immune Health* Promotes Healthy Intestinal Function* Restore -- Balance -- Protect Probiotic Supplement Dairy Free Kyo-Dophilus is formulated with three specially cultured, human, non-dairy, heat-stable, stomach acid resistant strains of beneficial bacteria. This Friendly Trio gives you relief from the inconvenience caused by bad bacteria. Take Kyo-Dophilus during and after a cycle of medication, when you travel, and every day to boost immunity, promote healthy intestinal function and general well-being.* Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Co... concerns/womens health/yeast infection/acidophilus/wakunaga kyolic kyo-dophilus 180 capsules.aspx
*  Wakunaga (Kyolic) - Kyo-Dophilus 180 Capsules - Save 38%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Heartburn > Digestion > Acidophilus View Larger Image Wakunaga (Kyolic) (more from Wakunaga (Kyolic) ) Kyo-Dophilus 180 Capsules Item No. 51-538-934 UPC: 023542600422 Retail Price: $33.95 Your Price: $20.95 Save: 38% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 90 C $12.45 Label Information Ingredients Reviews Digestion & Immune Health* Promotes Healthy Intestinal Function* Restore -- Balance -- Protect Probiotic Supplement Dairy Free Kyo-Dophilus is formulated with three specially cultured, human, non-dairy, heat-stable, stomach acid resistant strains of beneficial bacteria. This Friendly Trio gives you relief from the inconvenience caused by bad bacteria. Take Kyo-Dophilus during and after a cycle of medication, when you travel, and every day to boost immunity, promote healthy intestinal function and general well-being.* Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 180... concerns/heartburn/digestion/acidophilus/wakunaga kyolic kyo-dophilus 180 capsules.aspx
*  Wakunaga (Kyolic) - Kyo-Dophilus 180 Capsules - Save 38%
Order 1-800-338-7979 24-hrs. Category > Health Concerns > Urinary Tract View Larger Image Wakunaga (Kyolic) (more from Wakunaga (Kyolic) ) Kyo-Dophilus 180 Capsules Item No. 51-538-934 UPC: 023542600422 Retail Price: $33.95 Your Price: $20.95 Save: 38% OFF Quantity: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Add to Cart In stock Other sizes 90 C $12.45 Label Information Ingredients Reviews Digestion & Immune Health* Promotes Healthy Intestinal Function* Restore -- Balance -- Protect Probiotic Supplement Dairy Free Kyo-Dophilus is formulated with three specially cultured, human, non-dairy, heat-stable, stomach acid resistant strains of beneficial bacteria. This Friendly Trio gives you relief from the inconvenience caused by bad bacteria. Take Kyo-Dophilus during and after a cycle of medication, when you travel, and every day to boost immunity, promote healthy intestinal function and general well-being.* Ingredients Supplement Facts Serving Size 1 Capsule Servings Per Container 180 Amount Per Serving % ... concerns/urinary tract/wakunaga kyolic kyo-dophilus 180 capsules.aspx
*  Bifidobacterium longum
longum' is not significantly present in the adult gastrointestinal tract, it is considered part of the gut flora and its production of lactic acid is believed to prevent growth of pathogenic organisms. 5 Classification Environment Metabolism Probiotic health benefits Therapeutic uses Cancer treatment. Pancreatic necrosis. References Further Reading External links. In 2002, three previously distinct species of 'Bifidobacterium', 'B. longum', there exists an interest in the exact classification of new strains, although this is made difficult by the high gene similarity between the three biotypes. longum' colonizes the human gastrointestinal tract where it, along with other 'Bifidobacterium', represents up to 90% of the bacteria of an infant’s gastrointestinal tract. longum' were found to have high tolerance for gastric acid and bile, suggesting that these strains would be able to survive the gastrointestinal tract to colonize the lower small and large intestines. longum' also have bile salt hydrolases to hydrol...
*  In vitro evaluation of the microbiota modulation abilities of different sized whole oat grain flake
... s. University of Reading. CentAUR: Central Archive at the University of Reading. In vitro evaluation of the microbiota modulation abilities of different sized whole oat grain flakes. Wordle Link RDF+XML BibTeX RIOXX2 XML RDF+N-Triples JSON Dublin Core Atom Simple Metadata Refer METS HTML Citation with IDs HTML Citation ASCII Citation OpenURL ContextObject EndNote OpenURL ContextObject in Span MODS MPEG-21 DIDL EP3 XML Dublin Core Reference Manager RDF+N3. M 2010 In vitro evaluation of the microbiota modulation abilities of different sized whole oat grain flakes. The prebiotic potential of whole grains may be related, however, little is known about the microbiota modulatory capability of oat grain or the impact processing has on this ability. In this study the fermentation profile of whole grain oat flakes, processed to produce two different sized flakes small and large, by human faecal microbiota was investigated in vitro. Simulated digestion and subsequent fermentation by gut bacteria was investigated us...
*  N-acetylhexosamine 1-kinase
n acetylhexosamine kinase n acetylhexosamine kinase n acetylhexosamine kinase nahk lnpb n acetylgalactosamine n acetylglucosamine kinase is an enzyme with system name atp n acetyl d hexosamine phosphotransferase this enzyme catalyses the following chemical reaction atp n acetyl d hexosamine rightleftharpoons adp n acetyl alpha d hexosamine phosphate this enzyme is involved in the lacto n biose i galacto n biose degradation pathway in the probiotic bacterium bifidobacterium longum references external links category ec...
*  Careers | DJO Global
Careers. DJO Global. . Menu. International. Europe Australia Belgium Dutch Belgium French Canada English Canada French China Danmark Finland France Germany Ireland Italy Luxemburg Nederland Norway South Africa Spain Sweden United Kingdom. Facebook Twitter YouTube. Search form. Search this site. DJO Global. Home Motion is Medicine. Introduction The Healthcare Reality MotionCARE Product Protocols. Brands Products. Aircast DJO Surgical Fast Freeze Bell-Horn Dr. Comfort ProCare Chattanooga DonJoy Saunders CMF DonJoy Performance Empi DVT Compex Exos VitalStim. Services. DJO Healthcare Services. Education. Videos Patient Education Medical Education. Innovation. R D Overview R D Lean Process R D Awards Recognitions. Corporate Info. About Us. Vision Mission History Management Team Board of Directors Partnerships. Contact Us. Contacts by Brand Worldwide Contacts Sales Rep Locator Order Tracking. Careers. US Opportunities International Opportunities Distributor Partner Opportunities More. Investors. Press Releases Call...

Bifidobacterium longum: Bifidobacterium longum is a gram-positive, catalase-negative, rod-shaped bacterium present in the human gastrointestinal tract and one of the 32 species that belong to the genus Bifidobacterium. It is a micro-aerotolerant anaerobe and considered to be one of the earliest colonizers of the gastrointestinal tract of infants.Beef cattle: Beef cattle are cattle raised for meat production (as distinguished from dairy cattle, used for milk production). The meat of adult cattle is known as beef.Subtherapeutic antibiotic use in swine: Antibiotics are commonly used in commercial swine production in the United States and around the world. They are used for disease treatment, disease prevention and control, and growth promotion.Congenital chloride diarrhea: Congenital chloride diarrhea (CCD, also congenital chloridorrhea or Darrow Gamble syndrome) is a genetic disorder due to an autosomal recessive mutation on chromosome 7. The mutation is in downregulated-in-adenoma (DRA), a gene that encodes a membrane protein of intestinal cells.Dry matter: The dry matter (or otherwise known as dry weight) is a measurement of the mass of something when completely dried.Haustrum (anatomy): The haustra (singular haustrum) of the colon are the small pouches caused by sacculation (sac formation), which give the colon its segmented appearance. The teniae coli run the length of the large intestine.Bile: Bile or gall is a dark green to yellowish brown fluid, produced by the liver of most vertebrates, that aids the digestion of lipids in the small intestine. In humans, bile is produced continuously by the liver (liver bile), and stored and concentrated in the gallbladder (gallbladder bile).Thermal cyclerCampylobacter concisus: Campylobacter concisus is a Gram-negative, spiral, and microaerophilic bacteria. Motile, with either unipolar or bipolar flagella, the organisms have a characteristic spiral/corkscrew appearance and are oxidase-positive.Lactobacillus sanfranciscensis: Lactobacillus sanfranciscensis (formerly L. sanfrancisco) is a species of lactic acid bacteria that helps give sourdough bread its characteristic taste.CecectomyBiotransformation: Biotransformation is the chemical modification (or modifications) made by an organism on a chemical compound. If this modification ends in mineral compounds like CO2, NH4+, or H2O, the biotransformation is called mineralisation.Osmotic controlled-release oral delivery system: OROS (Osmotic [Controlled] Release Oral [Delivery] System) is a controlled release oral drug delivery system in the form of a tablet. The tablet has a rigid water-permeable jacket with one or more laser drilled small holes.Eubacterium oxidoreducens: Eubacterium oxidoreducens is a Gram positive bacterium species in the genus Eubacterium.Escherichia coli O121: Escherichia coli O121 is a serotype of Escherichia coli, a species of bacteria that lives in the lower intestines of mammals.http://www.Short-chain fatty acid: Short-chain fatty acids (SCFAs), also referred to as volatile fatty acids (VFAs),"Role of Volatile Fatty Acids in Development of the Cecal Microflora in Broiler Chickens during Growth" at are fatty acids with an aliphatic tail of less than six carbon atoms.Lactic acid fermentationCryptosporidiosisGiardia: Giardia ( or ) is a genus of anaerobic flagellated protozoan parasites of the phylum Sarcomastigophora that colonise and reproduce in the small intestines of several vertebrates, causing giardiasis. Their life cycle alternates between an actively swimming trophozoite and an infective, resistant cyst.Bismuth sulfite agar: Bismuth sulfite agar is a type of agar media used to isolate Salmonella species. It uses glucose as a primary source of carbon.Clostridium phytofermentans: Clostridium phytofermentans is an obligately anaerobic, rod-shaped, gram-positive bacterium. It forms spherical spores.Amplified Ribosomal DNA Restriction Analysis: Amplified rDNA (Ribosomal DNA) Restriction Analysis is the extension of the technique of RFLP (restriction fragment length polymorphism) to the gene encoding the small (16s) ribosomal subunit of bacteria. The technique involves an enzymatic amplification using primers directed at the conserved regions at the ends of the 16s gene, followed by digestion using tetracutter Restriction enzymes.Exogenous bacteria: Exogenous bacteria are microorganisms introduced to closed biological systems from the external world. They exist in aquatic and terrestrial environments, as well as the atmosphere.Atoxoplasma: Atoxoplasma is a genus of parasitic protozoa in the phylum Apicomplexa. The species in this genus infect birds.Mayo Clinic Diet: The Mayo Clinic Diet is a diet created by Mayo Clinic. Prior to this, use of that term was generally connected to fad diets which had no association with Mayo Clinic.Alpha SerpentisBranching order of bacterial phyla (Gupta, 2001): There are several models of the Branching order of bacterial phyla, one of these was proposed in 2001 by Gupta based on conserved indels or protein, termed "protein signatures", an alternative approach to molecular phylogeny. Some problematic exceptions and conflicts are present to these conserved indels, however, they are in agreement with several groupings of classes and phyla.Canadian Thoroughbred Horse Society: The Canadian Thoroughbred Horse Society (CTHS) is an organization headquartered in Toronto, Canada that was founded in 1906 to assist Thoroughbred horse breeders. Since 1982, there have been provincial divisions in Alberta, British Columbia, Manitoba, Ontario, Quebec and Saskatchewan.Porcine intestinal spirochaetosis: Porcine intestinal spirochaetosis is a notifiable pig disease caused by the bacterium Brachyspira pilosicoli. Infection causes mild gastrointestinal signs in young pigs and intestinal spirochetosis in humans, as it is a zoonosis.DNA sequencer: A DNA sequencer is a scientific instrument used to automate the DNA sequencing process. Given a sample of DNA, a DNA sequencer is used to determine the order of the four bases: G (guanine), C (cytosine), A (adenine) and T (thymine).Jet aeratorsCarbon-12: Carbon-12 is the more abundant carbon of the two stable isotopes, amounting to 98.93% of the element carbon; its abundance is due to the triple-alpha process by which it is created in stars.Eagle's minimal essential medium: Eagle's minimal essential medium (EMEM) is a cell culture medium developed by Harry Eagle that can be used to maintain cells in tissue culture.Complete Wheat Bran Flakes: Kellogg's Complete Wheat Bran Flakes is a breakfast cereal containing 100% of the United States' Recommended Dietary Allowance of eleven vitamins and minerals, including vitamins B1, B3, B5, B6, B12, C, E, and Iron, Riboflavin, Folic Acid, and Zinc. One 3/4 cup serving contains 3 grams of protein, 5 grams of dietary fiber and 90 calories, 5 of which come from fat.Bile acid malabsorptionUnited States regulation of point source water pollution: Point source water pollution comes from discrete conveyances and alters the chemical, biological, and physical characteristics of water. It is largely regulated by the Clean Water Act (CWA) of 1972.Nitrogen deficiencyKennel clubColt Crag Reservoir: Colt Crag Reservoir is a relatively shallow reservoir in Northumberland, England adjacent to the A68 road, and north of Corbridge. The A68 road at this point runs along the course of Dere Street, a Roman road.Depth Charge (horse): Depth Charge (1941–1965) was a Thoroughbred son of Bold Venture who went on to become an outstanding sire of American Quarter Horse racehorses.Simmons Legends: Outstanding Quarter Horse Stallions and Mares p.Mutaflor: Mutaflor is a probiotic consisting of a viable non-pathogenic bacteria strain named Escherichia coli Nissle 1917.Mutaflor Information page "The Escherichia coli strain Nissle 1917-designated DSM 6601 in the German Collection for Microorganisms in Braunschweig is one of the best-examined and therapeutically relevant bacterial strains worldwide" as claimed by the manufacturerManufacturers WebsiteReplica plating: 350px|right|thumb|[[Negative selection (artificial selection)|Negative selection through replica plating to screen for ampicillin sensitive colonies]]Eimeria acervulina: Eimeria acervulina is a species of Eimeria that causes coccidiosis in older poultry. Lesions are limited to the anterior or first third of the small intestine.Assay sensitivity: Assay sensitivity is a property of a clinical trial defined as the ability of a trial to distinguish an effective treatment from a less effective or ineffective intervention. Without assay sensitivity, a trial is not internally valid and is not capable of comparing the efficacy of two interventions.CampylobacteriosisColes PhillipsHigh-performance liquid chromatography: High-performance liquid chromatography (HPLC; formerly referred to as high-pressure liquid chromatography), is a technique in analytical chemistry used to separate, identify, and quantify each component in a mixture. It relies on pumps to pass a pressurized liquid solvent containing the sample mixture through a column filled with a solid adsorbent material.List of strains of Escherichia coli: Escherichia coli is a well studied bacterium that was first identified by Theodor Escherich, after whom it was later named.Goose egg addling: Goose egg “addling” is a wildlife management method of population control for Canada geese and other bird species. The process of addling involves temporarily removing fertilized eggs from the nest, testing for embryo development, terminating embryo development, and placing the egg back in the nest.Obstructed defecation: Obstructed defecation (also known as rectal outlet obstruction, evacuatory dysfunction, obstructed defecation syndrome, outlet constipation, and pelvic outlet obstruction), is "difficulty in evacuation or emptying the rectum [which] may occur even with frequent visits to the toilet and even with passing soft motions". The conditions that can create the symptom are sometimes grouped together as defecation disorders.Cryptosporidium parvum: Cryptosporidium parvum is one of several protozoal species that cause cryptosporidiosis, a parasitic disease of the mammalian intestinal tract.Viral gastroenteritis: Viral gastroenteritis (Gastro-Enter-eye,tiss),http://www.merriam-webster.Powdered milk: Powdered milk or dried milk is a manufactured dairy product made by evaporating milk to dryness. One purpose of drying milk is to preserve it; milk powder has a far longer shelf life than liquid milk and does not need to be refrigerated, due to its low moisture content.Fecal coliform: A fecal coliform (British: faecal coliform) is a facultatively anaerobic, rod-shaped, gram-negative, non-sporulating bacterium. Coliform bacteria generally originate in the intestines of warm-blooded animals.Angang Sewage Disposal Plant: The Angang Sewage Disposal Plant is a sewage treatment plant located in the city of Gyeongju, North Gyeongsang province, South Korea. It began operating in April, 2005 by the co-investment of the Government of North Gyeongsang and Gyeongju City with a fund of 44,300,000,000 won to install the facilities to prevent the pollution of Hyeongsan River which is a main water source for Gyeongju and Pohang residents.Interbreeding of dingoes with other domestic dogs: The interbreeding of dingoes with other domestic dogs is an ongoing process affecting the population of free ranging domestic dogs in Australia. The current population of free ranging domestic dogs in Australia is now probably higher than in the past.Ariostralis nebulosa: Ariostralis nebulosa is a species of air-breathing land slug, a terrestrial, pulmonate, gastropod mollusk in the family Oopeltidae.EnteritisMcIntosh and Filde's anaerobic jar: McIntosh and Filde's anaerobic jar is an instrument used in the production of an anaerobic environment. This method of anaerobiosis as others is used to culture bacteria which die or fail to grow in presence of oxygen (anaerobes).Corriedale: Corriedale sheep are a dual purpose breed, meaning they are used both in the production of wool and meat. The Corriedale is the oldest of all the crossbred breeds, a Merino-Lincoln cross developed almost simultaneously in Australia and New ZealandStock Types, The Land, North Richmond, c.Coccidiosis: Coccidiosis is a parasitic disease of the intestinal tract of animals caused by coccidian protozoa. The disease spreads from one animal to another by contact with infected feces or ingestion of infected tissue.Clostridium perfringens beta toxin: Clostridium perfringens beta toxin is one of the four major lethal toxins produced by Clostridium perfringens Type B and Type C strains. It is a necrotizing agent and it induces hypertension by release of catecholamine.Old German Shepherd Dog: Old German Shepherd Dog () is a controversial predicate for the long-hair variation of the German Shepherd Dog (), which is not a separate breed recognized by the Fédération Cynologique Internationale. Nonetheless, there are efforts to establish this variety as a separate breed.Intestinal parasite

(1/13394) Strongyle infections in ponies. I. Response to intermittent thiabendazole treatments.

A group of seven ponies naturally infected with large numbers of small strongyles and raised under conditions to minimize reinfection were treated periodically over a three year span with thiabendazole at the rate of 44 mg/kg body weight. Based on the absence of worm eggs in the feces following each treatment, thiabendazole removed the adult strongyles present with a new population subsequently developing by maturation of inhibited larvae. It took as many as four or five treatments to eliminate or reduce significantly the worm burdens present in the ponies under the conditions of this study. Strongyle eggs started to reappear in the feces about six weeks after treatment and following the first treatment the mean egg counts rose to the pretreatment level. On successive treatments the interval for worm eggs to appear in the feces lengthened and mean egg counts never rose quite as high as immediate pretreatment levels. Hematological changes were not marked, although a small steady increase in the mean hemoglobin values and an equivalent small decrease in the mean eosinophil counts occurred in all ponies following each successive treatment. The study supports the rationale of regular anthelmintic treatment of horses in that even in the absence of reinfection, new burdens of adult worms develop following treatment.  (+info)

(2/13394) Strongyle infections in ponies. II. Reinfection of treated animals.

Five of seven ponies whose strongyle worm burdens had previously been removed or markedly reduced by repeated thiabendazole treatments were reinfected with doses ranging from 100,000 to 500,000 small strongyle infective larvae. Reinfection of ponies resulted in the development of clinical signs characterized by abnormal feces, marked loss of weight and delayed shedding of winter hair coats. An abrupt increase in circulating eosinophils occurred during the first three weeks following reinfection. Patent infections developed in all ponies with worm eggs appearing in the feces from 12 to 15 weeks after receiving infective larvae. Worm egg outputs followed a cyclic pattern with approximately four to five peaks in egg output per year. There was an abrupt drop in the high worm egg counts in two untreated ponies approximately two and a half years after reinfection. No worms were recovered in the feces of these animals when they were subsequently treated, suggesting that a depletion in the number of inhibited larvae present in these ponies might have occurred.  (+info)

(3/13394) Effects of dispersed recreational activities on the microbiological quality of forest surface water.

The microbiological quality of forest surface waters in the Greenwater River watershed was examined to investigate the influence of heavy motorized camping in an area with no sanitary facilities. Indicator densities increased during weekend human-use periods when compared to weekdays. Increases in indicator densities were also noted downstream from heavily used camping areas when compared to upstream sites. Seasonal, weekly, and diurnal fluctuations in indicator densities were observed. This study suggests that potential health hazards exist in this watershed during periods of human use.  (+info)

(4/13394) Fecal coliform elevated-temperature test: a physiological basis.

The physiological basis of the Eijkman elevated-temperature test for differentiating fecal from nonfecal coliforms was investigated. Manometric studies indicated that the inhibitory effect upon growth and metabolism in a nonfecal coliform at 44.5 degrees C involved cellular components common to both aerobic and fermentative metabolism of lactose. Radioactive substrate incorporation experiments implicated cell membrane function as a principal focus for temperature sensitivity at 44.5 degrees C. A temperature increase from 35 to 44.5 degrees C drastically reduced the rates of [14C]glucose uptake in nonfecal coliforms, whereas those of fecal coliforms were essentially unchanged. In addition, relatively low levels of nonfecal coliform beta-galactosidase activity coupled with thermal inactivation of this enzyme at a comparatively low temperature may also inhibit growth and metabolism of nonfecal coliforms at the elevated temperature.  (+info)

(5/13394) Persistent damage to Enterocytozoon bieneusi, with persistent symptomatic relief, after combined furazolidone and albendazole in AIDS patients.

AIM: To investigate morphological changes in Enterocytozoon bieneusi and the duration of symptomatic relief after combination treatment with furazolidone and albendazole in AIDS patients. METHODS: Four severely immunocompromised AIDS patients with symptomatic E bieneusi infection of the gut received an 18 day course of combined furazolidone and albendazole (500 + 800 mg daily). All patients were monitored for parasite shedding in stool by light microscopy at the end of treatment and monthly during follow up. At the end of treatment, duodenal biopsy specimens obtained from three patients were studied by transmission electron microscopy by two pathologists blind to the patients' treatment or clinical outcome. Duodenal biopsy specimens obtained from one of the patients two months after completion of treatment were also studied electronmicroscopically. RESULTS: All patients had long lasting symptomatic relief, with a major decrease--or transient absence--of spore shedding in stools from completion of treatment. After treatment, changes in faecal spores were persistently found by light microscopy in all cases, and there was evidence of both a substantial decrease in the parasite load and ultrastructural damage in the parasite in all biopsy specimens. The treatment was well tolerated, and no patient had clinical or parasitological relapse during follow up (up to 15 months). CONCLUSIONS: The long lasting symptomatic relief observed in all four treated patients correlated with the persistent decrease in parasite load both in tissue and in stool, and with the morphological changes observed in the life cycle of the protozoan. These data suggest that combined treatment with furazolidone and albendazole is active against E bieneusi and may result in lasting remission even in severely immunocompromised patients.  (+info)

(6/13394) Accumulation of astaxanthin all-E, 9Z and 13Z geometrical isomers and 3 and 3' RS optical isomers in rainbow trout (Oncorhynchus mykiss) is selective.

Concentrations of all-E-, 9Z- and 13Z- geometrical and (3R,3'R), (3R, 3'S) and (3S,3'S) optical isomers of astaxanthin were determined in rainbow trout liver, gut tissues, kidney, skin and blood plasma to evaluate their body distribution. Two cold-pelleted diets containing predominantly all-E-astaxanthin (36.9 mg/kg astaxanthin, 97% all-E-, 0.4% 9Z-, 1.5% 13Z-astaxanthin, and 1.1% other isomers, respectively) or a mixture of all-E- and Z-astaxanthins (35.4 mg/kg astaxanthin, 64% all-E-, 18.7% 9Z-, 12.3% 13Z-astaxanthin, and 2.0% other isomers, respectively), were fed to duplicate groups of trout for 69 d. Individual E/Z isomers were identified by VIS- and 1H-NMR-spectrometry, and quantified by high-performance liquid chromatography. Significantly higher total carotenoid concentration was observed in plasma of trout fed diets with all-E-astaxanthin (P < 0.05). The relative E/Z-isomer concentrations of plasma, skin and kidney were not significantly different among groups, whereas all-E-astaxanthin was higher in intestinal tissues and 13Z-astaxanthin was lower in liver of trout fed all-E-astaxanthin (P < 0.05). The relative amount of hepatic 13Z-astaxanthin (39-49% of total astaxanthin) was higher than in all other samples (P < 0.05). Synthetic, optically inactive astaxanthin was used in all experiments, and the determined dietary ratio between the 3R,3'R:3R, 3'S (meso):3S,3'S optical isomers was 25.3:49.6:25.1. The distribution of R/S-astaxanthin isomers in feces, blood, liver and fillet was similar to that in the diets. The ratio between (3S,3'S)- and (3R,3'R)-astaxanthin in the skin and posterior kidney was ca. 2:1 and 3:1, respectively, regardless of dietary E/Z-astaxanthin composition. The results show that geometrical and optical isomers of astaxanthin are distributed selectively in different tissues of rainbow trout.  (+info)

(7/13394) Sodium requirement of adult cats for maintenance based on plasma aldosterone concentration.

The sodium requirement of adult cats for maintenance was determined using a randomized block design of eight dietary sodium treatments (0.1, 0.4, 0.5, 0.66, 0.8, 1.2, 1.6 or 2.0 g Na/kg in a casein-lactalbumin-based purified diet) administered for periods of 4 wk. A total of 35 adult specific-pathogen-free domestic shorthaired cats (26 males and 9 females, 1.5-3 y of age) was given an equilibration diet (2 g Na/kg) for 14 d before assignment (or reassignment) to the treatments. A total of 12 cats (8 males, 4 females) was randomly assigned to the lowest six levels of sodium, and four cats to the highest two sodium levels. Cats consuming the diet containing 0.1 g Na/kg had significantly elevated aldosterone concentration in plasma, and packed cell volume. In addition, these cats exhibited anorexia, body weight loss, reduced urinary specific gravity and sodium excretion, and had a negative sodium balance. However, adult cats did not develop polydypsia and polyuria reported in sodium-deficient kittens. Cats given the diet containing 0.66 g Na/kg did not have an increased packed cell volume, but aldosterone concentration in the plasma was significantly elevated. However, cats given diets containing >/=0.8 g Na/kg had plasma aldosterone concentrations +info)

(8/13394) Serotypes and virulence factors of Escherichia coli strains isolated from dogs and cats.

E. coli strains isolated from urine of dogs and cats with urinary tract infections (UTI) and from feces of healthy one's were serotyped, and the serotypes were correlated with uropathogenic virulence factors. The most prevalent O-serotypes, O4 and O6, were isolated from dogs and cats with UTI. In contrast, O11 and O102 strains were the most frequently found from feces of healthy dogs and cats. Most of type O4 and O6 strains possessed such virulence factors as pil, pap, sfa, hly, and cnf1, while most type O11 and O102 strains pil only or pil and aer. All strains of type O75 possessed afaI and aer. K1 antigen was negative in all strains obtained from UTI.  (+info)


today, i've been having diarrhea and the last time I had a piece of my poop was reddish and when I wiped using toilet paper, there was a bit of blood. what's happening to me? and can i still drink milk?

DON'T DRINK MILK if you have diarrhea. It makes it worse.

It sounds as if your anus is becomeing inflammed from the loose bowel motions causing some bleeding when wiping.

You may just have a stomach bug that will pass in it's own time.
Don't take any anti-diarrhea pills if you can as it's your bodies way of trying to rid what's upsetting the guts. If you stop the diarreah the bug stays in the system longer.

If you start to feel sick in the stomach and/or vomiting, you may need to make an appointment to see your Doctor for some anti-emetic meds.

Keep up your fluids. Drink Gastrolyte. It's designed for this.

Ramifications of putting a FECES SOLUTION in a bottle and spraying it on people?

My friend and I are both seniors in high school. We have people we have to get revenge on, so we're planning on s*** (poop) misting. This is when one mixes any sort of fecal matter with water, puts it in a spray bottle, then sprays it on things that people would come in contact with. We are going to spray actual people directly though.

I was wondering what the legal and health ramifications of this are. Remember that the feces will be in trace amounts.

Thanks everyone!

Awful idea. At least use like a stinky perfume or something. To spray feces on someone would be an extreme offense because feces contain E. coli and other bacteria (always, not just if you are sick). Feces are a biohazard, just like urine and blood. 

Basically, how do you think people would react if you went up to them and gave them a shot of a stranger's blood? It's about the same. You can get into a LOT of trouble for that. Go with stinky perfume.

People who eat human feces and drink urine to satisfy sexual desires.What is health hazards?

I have heard about this that they are people who enjoy eating human feces and drinking human urine for sexual desires. I know that human feces has a lot of dangers but why these people don't get sick?

If they are doing that ,,,,no wonder they can't get laid.

What mental illness has the highest percentage of feces smearers?

What mental illness is someone most likely to be a feces smearer? Is it Autism or Skitsofrenia or something else?


What is the scientific name for the ingestion of human feces?

Does it include the imbibement of human urine? Is the term the same for the ingestion of feces from any other mammal by a human being? Is the term exclusive to feces? Is anyone out there attracted sexually to human feces? If so, what does it taste like?

Coprophagia  - Eating of excrement. Source - Medical Subject Headings for PubMed

coprophagy - the eating of excrement that is normal behavior among many especially young animals but in humans is a symptom of some forms of insanity. Source - Merriam Webster Medical Dictionary

What does it mean when your feces are gray?

I just went to the bathroom and my feces were gray and runny.
What does that mean?

If you have been taking over the counter of prescription medication, it may mean that you took too much.
Or it could mean that you are eating something that your body is not able to digest properly.

How long does it take for human feces take to turn white when outside?

How long does it take for human feces take to turn white when outside?

the same ammount of time for you to grow a brain.. centuries..

It doesnt change to white, sorry budd

What does my feces resemble cow patties?

Well for the past four to five months, my feces has been either extremely watery (typical diarrhea) or has resembled a cow pattie (not formed, almost peanut butter like in consistency and great in quantity). I have very rarely had what would be considered a typical bowel movement (a tubular object) and it is, while gross, quite disconcerting. Can anyone give me some insight into this phenomenon?
It should be mentioned that my dietary habits haven't changed any and that I am a male.

Time to go to your doctor, this could be an indication of a food allergy or intolerance (e.g. lactose, gluten) or colitis amongst other things.
The only way to determine the cause is to go to your doctor and get some testing done!