Dietary Sucrose: Sucrose present in the diet. It is added to food and drinks as a sweetener.Sucrose: A nonreducing disaccharide composed of GLUCOSE and FRUCTOSE linked via their anomeric carbons. It is obtained commercially from SUGARCANE, sugar beet (BETA VULGARIS), and other plants and used extensively as a food and a sweetener.Dietary Carbohydrates: Carbohydrates present in food comprising digestible sugars and starches and indigestible cellulose and other dietary fibers. The former are the major source of energy. The sugars are in beet and cane sugar, fruits, honey, sweet corn, corn syrup, milk and milk products, etc.; the starches are in cereal grains, legumes (FABACEAE), tubers, etc. (From Claudio & Lagua, Nutrition and Diet Therapy Dictionary, 3d ed, p32, p277)Oligo-1,6-Glucosidase: An enzyme that catalyzes the endohydrolysis of 1,6-alpha-glucosidic linkages in isomaltose and dextrins produced from starch and glycogen by ALPHA-AMYLASES. EC Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Jejunum: The middle portion of the SMALL INTESTINE, between DUODENUM and ILEUM. It represents about 2/5 of the remaining portion of the small intestine below duodenum.Dietary Fats: Fats present in food, especially in animal products such as meat, meat products, butter, ghee. They are present in lower amounts in nuts, seeds, and avocados.Dietary Proteins: Proteins obtained from foods. They are the main source of the ESSENTIAL AMINO ACIDS.Diet: Regular course of eating and drinking adopted by a person or animal.Dietary Fiber: The remnants of plant cell walls that are resistant to digestion by the alimentary enzymes of man. It comprises various polysaccharides and lignins.Dietary Supplements: Products in capsule, tablet or liquid form that provide dietary ingredients, and that are intended to be taken by mouth to increase the intake of nutrients. Dietary supplements can include macronutrients, such as proteins, carbohydrates, and fats; and/or MICRONUTRIENTS, such as VITAMINS; MINERALS; and PHYTOCHEMICALS.Calcium, Dietary: Calcium compounds used as food supplements or in food to supply the body with calcium. Dietary calcium is needed during growth for bone development and for maintenance of skeletal integrity later in life to prevent osteoporosis.Dietary Fats, Unsaturated: Unsaturated fats or oils used in foods or as a food.Cholesterol, Dietary: Cholesterol present in food, especially in animal products.Energy Intake: Total number of calories taken in daily whether ingested or by parenteral routes.Sodium, Dietary: Sodium or sodium compounds used in foods or as a food. The most frequently used compounds are sodium chloride or sodium glutamate.Food Habits: Acquired or learned food preferences.Iron, Dietary: Iron or iron compounds used in foods or as food. Dietary iron is important in oxygen transport and the synthesis of the iron-porphyrin proteins hemoglobin, myoglobin, cytochromes, and cytochrome oxidase. Insufficient amounts of dietary iron can lead to iron-deficiency anemia.Body Weight: The mass or quantity of heaviness of an individual. It is expressed by units of pounds or kilograms.Animal Feed: Foodstuff used especially for domestic and laboratory animals, or livestock.Potassium, Dietary: Potassium or potassium compounds used in foods or as foods.Sweetening Agents: Substances that sweeten food, beverages, medications, etc., such as sugar, saccharine or other low-calorie synthetic products. (From Random House Unabridged Dictionary, 2d ed)Vegetables: A food group comprised of EDIBLE PLANTS or their parts.Centrifugation, Density Gradient: Separation of particles according to density by employing a gradient of varying densities. At equilibrium each particle settles in the gradient at a point equal to its density. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Eating: The consumption of edible substances.Food Preferences: The selection of one food over another.Diet Records: Records of nutrient intake over a specific period of time, usually kept by the patient.Fructose: A monosaccharide in sweet fruits and honey that is soluble in water, alcohol, or ether. It is used as a preservative and an intravenous infusion in parenteral feeding.Fruit: The fleshy or dry ripened ovary of a plant, enclosing the seed or seeds.Diet Surveys: Systematic collections of factual data pertaining to the diet of a human population within a given geographic area.Recommended Dietary Allowances: The amounts of various substances in the diet recommended by governmental guidelines as needed to sustain healthy life.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.Animal Nutritional Physiological Phenomena: Nutritional physiology of animals.Taste: The ability to detect chemicals through gustatory receptors in the mouth, including those on the TONGUE; the PALATE; the PHARYNX; and the EPIGLOTTIS.Fatty Acids: Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)beta-Fructofuranosidase: A glycoside hydrolase found primarily in PLANTS and YEASTS. It has specificity for beta-D-fructofuranosides such as SUCROSE.Glucosyltransferases: Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.Nutrition Policy: Guidelines and objectives pertaining to food supply and nutrition including recommendations for healthy diet.Random Allocation: A process involving chance used in therapeutic trials or other research endeavor for allocating experimental subjects, human or animal, between treatment and control groups, or among treatment groups. It may also apply to experiments on inanimate objects.Nutrition Assessment: Evaluation and measurement of nutritional variables in order to assess the level of nutrition or the NUTRITIONAL STATUS of the individual. NUTRITION SURVEYS may be used in making the assessment.Cholesterol: The principal sterol of all higher animals, distributed in body tissues, especially the brain and spinal cord, and in animal fats and oils.Fish Oils: Oils high in unsaturated fats extracted from the bodies of fish or fish parts, especially the LIVER. Those from the liver are usually high in VITAMIN A. The oils are used as DIETARY SUPPLEMENTS. They are also used in soaps and detergents and as protective coatings.Weight Gain: Increase in BODY WEIGHT over existing weight.Cereals: Seeds from grasses (POACEAE) which are important in the diet.

*  Publication : USDA ARS
Dietary fructose and glucose differentially ... Both table sugar or sucrose and high fructose corn syrup contain ... is now clear that dietary glucose is primarily taken up by many...
*  Lirias: Effect of dietary sucrose and glucose on fatty-acid acyl desaturase activities in rat-liver
Lirias: Effect of dietary sucrose and glucose on fatty-acid acyl ... Title: Effect of dietary sucrose and glucose on fatty-acid acyl...
*  Alcnet | Rakuten Global Market: ■ latest dietary supplement! fs04gm
Market: ■ latest dietary supplement. fs04gm. Rakuten Global ... ■ latest dietary supplement. fs04gm. Share this Page ... cellulose, sucrose ester, silicon dioxide, vitamin pre mix...
*  Fructose
Compared with sucrose. 9 thumb|center|400px|'''Figure 2:''' ... The highest dietary sources of fructose, besides pure ... table sugar sucrose , high-fructose corn syrup , agave ... High-fructose corn syrup HFCS is a mixture of glucose and fructose as monosaccharides. Metabolism of fructose to DHAP and glyceraldehyde. Synthesis of glycogen from DHAP and glyceraldehyde 3-phosphate. Synthesis of triglyceride from DHAP and glyceraldehyde 3-phosphate. Compared with sucrose. 9 thumb|center|400px|'Figure 2:' Relative sweetness of sugars and sweeteners. The highest dietary sources of fructose, besides pure crystalline fructose, are foods containing table sugar sucrose, high-fructose corn syrup, agave nectar, honey, molasses, maple syrup, fruit and fruit juice s, as these have the highest percentages of fructose including fructose in sucrose per serving compared to other common foods and ingredients. Fructose, glucose, and sucrose may all be present in a food; however, different foods will have varying levels of ...
*  ACP: InternistWeekly - 17 August 2010
B Decrease dietary animal protein intake C Increase dietary calcium intake D Increase dietary sucrose intake Click here or scroll to the ... an increase in her dietary calcium intake. Calcium oxalate stones...
*  Dietary Sucrose - Table Sugar Summary Report | CureHunter
Dietary Sucrose Table Sugar. Also Known As: Table Sugar ... ; Dietary Sugars; Sucrose, Dietary; Sugars, Dietary. 1 Body ... Body 01/01/2013 - " Dietary sugars and body weight: systematic...
*  Container size influences snack food intake independently of portion size.
Diet / psychology* Dietary Sucrose / administration dosage Eating ... Young Adult. 0/Dietary Sucrose. Appetite. Next Document:...
*  madagascar poison frogs News and Photos | Perez Hilton
of animal producing sucrose filed under wacky tacky true ... contain the sugar sucrose which marks them as the first known ... sap secrete sucrose sugar tauromantellic acid...
*  Edit Post -- Tiki Central
also sweetened with sucrose, which is basically refined sugar that ... turbinado, or pure sucrose that is derived from sugarcane, as...
*  山羊抗鸡IgY(SureLight® Allophycocyanin)
: 0.1% BSA, 50mM Sucrose, 150mM Sodium chloride, 100mM Sodium...
*  KAKEN Biological treatment of dissolved organic matter by antarctic psychrophilic yeast cells
such as glucose and sucrose. It was concluded that the eight...
*  Maggie Anne Nail Polish Tansy - LoveLula - FREE Delivery Worldwide
*  My low carb low sugar diet
... Register. Sign In. Search in:. Foods. Recipes. Meals. Challenges. Exercises. Members. Journals. Groups. Forums. Diets. Tips. My FatSecret. Foods. Recipes. Challenges. Fitness. Diets Community. Diets. Member Diets. My low carb low sugar diet. My low carb low sugar diet. Summary:. This is a low carb, low sugar diet, high vegetables. Suited for diabetics, or prediabetics. la karla's food tips. Foods you can have. Breads, Grains, Cereals, Pasta, Rice. Meat and Fish. Fruit and Fruit Juices. Vegetables and Legumes e.g. Dairy Products - Milk, Cheese, etc. Fats and Oils. Herbs, Spices, Sauces. Recent Activity for My low carb low sugar diet. View: all activity. journals. calendar. kitchen. tips. How To Follow My low carb low sugar diet:. The point is to change eating habits and acquire new healthier ones. Every week try to make a different change in habits and to meditate on the need to make the change. by member la karla. Hello all, my name is Karla, i am 35 this year, i am having a very hard time losing weight....
*  No Flour No Sugar Diet Food List
... Home Contact Us Sitemap. Weight Loss Diets Vegetarian Diets Diets For Blood Type Medical Diets. Breaking News. Ischemic Colitis Diet Plan The Best Practice. Catt Sadler Diet More Think About Eat. Acxion Diet Pills Questions And Answers. ABS Diet Food List. What is the Cenegenics Diet meal program. Home. Weight Loss Diets. No Flour No Sugar Diet Food List. No Flour No Sugar Diet Food List. People compassionate non-engaged nutritionist has to admit that a diet with such seemingly simple and obvious to any fool slogan in the title no flour no sugar diet food list a highly wise way to lose weight. Sedentary person yes, there is such evolutionary branch of Homo Sapiens, not to engage in strenuous physical work or exercise, for healthy nutrition, provide energy and necessary substance, not need any sweetener or white flour products. These are the carbohydrates from which sedentary people get grow fat. Also, many people have allergic to gluten, which is why they should avoid white bread, biscuits, pasta and lik...
*  Mylene Perreault - ResearchGate
... Mylene Perreault. Are you Mylene Perreault. Article:. Cynthia Rohde Mylene Perreault. Ruth E. DOI:10.4161/mabs.23826 4.56 Impact Factor. Article:. Mice Deleted for GPAT3 Have Reduced GPAT Activity in White Adipose Tissue and Altered Energy and Cholesterol Homeostasis in Diet-induced Obesity. Ronald W Clark Mylene Perreault. James F Tobin. Ruth E Gimeno. However, when fed a high-fat diet, female Gpat3 -/- mice showed decreased body weight gain and adiposity and increased energy expenditure. Article:. Ruth E Gimeno. In vivo, peripheral administration of TAM-163 decreased food intake and/or body weight in mice, rats, hamsters, and dogs, but increased food intake and body weight in monkeys. DOI:10.1371/journal.pone.0062616 3.23 Impact Factor. Article:. Cynthia Rohde Mylene Perreault. Ruth E Gimeno. 4.56 Impact Factor Source Available from: Xin Xu. Article:. When orally dosed in C57/BL6 diet-induced obesity DIO mice, HSD-621 was efficacious and showed a significant reduction in both fed and fasting glucose an...
*  The Nutrispec Letter 03-00
"THE DEADLY QUARTET." This is the name given by physiologists to the metabolic syndrome which includes: - obesity - elevated triglycerides - elevated blood pressure - diabetes The name derives from the fact that if you have these four conditions simultaneously you don't have much life to look forward to. Every one of your patients who shows a ketogenic tendency is a prime candidate for adult onset diabetes, plus, elevated blood pressure, elevated triglycerides and cardiovascular disease. Physiologists determined decades ago that insulin resistance was associated with high blood pressure, obesity, diabetes and elevated triglycerides. Did you have to be already obese before a high fat plus high sugar diet would cause insulin resistance. Here is the sequence: Step One - High Fat + High Sugar Diet. Step Two - Insulin Resistance - Decreased Glucose Transport - Elevated Serum Insulin Step Three - Elevated Serum Triglycerides - Increased Size of Abdominal Fat Cells Step Four - Elevated Blood Pressure - Increased Clo...
*  Diabetic fruit flies support buzz about dietary sugar dangers | Science Codex
Diabetic fruit flies support buzz about dietary sugar dangers. Science Codex. RSS Feeds » Sitewide. Earth. Heavens. Body. Brain. Culture. Technology. Home Earth Heavens Body Brain Culture Tech. Diabetic fruit flies support buzz about dietary sugar dangers Posted By News On January 17, 2013 - 5:31am. Tweet. LA JOLLA, Calif., January 15, 2013 – Regularly consuming sucrose—the type of sugar found in many sweetened beverages—increases a person's risk of heart disease. In a study published January 10 in the journal PLOS Genetics, researchers at Sanford-Burnham Medical Research Institute and Mount Sinai School of Medicine used fruit flies, a well-established model for human health and disease, to determine exactly how sucrose affects heart function. In addition, the researchers discovered that blocking this cellular mechanism prevents sucrose-related heart problems. "Our study reveals a number of specific sugar-processing enzymes that could be targeted with therapies aimed at reducing sucrose's unhealthy effects on...
*  Sugar Diet Chat In Urdu |
Sugar Diet Chat In Urdu. Scroll Log In. Register. SG Live. Follow. SG Live Recipes. Personalities Videos. Slideshows. Home. Fashion. Relationships. Parenting. Health. Lifestyle. Entertainment. Career. Shopping. Blogs. Polls. Forum. Groups. SG Live. Sugar diet chat in urdu:Forum Section. Diet chart for Sugar patients. by deepika755. 05 Apr, 2013. 1 replies. 1953 views. Please help me with some easy to follow diet chart for sugar patients Read More... Diet chart for Sugar patients. by megha433. 05 Apr, 2013. 1 replies. 1953 views. In India nearly 4.5 million people are suffering from diabetes. The meal of a diabetic patient depends on its age, gender, weight and working etc. Therefore different dietary charts are created for different persons. Below is given an easy to follow diet chart for a general diabetic patient. Morning At 6 am: fenugreek powder tea... Read More... Dry fruits name in Urdu. by pinky117. 09 May, 2013. 2 replies. 1444 views. I have never ever able to remember the name of dry fr...
*  :: Best Way To Beat Sugar Addiction : The 21 Day Sugar Detox Manual From Balanced Bites | Help Break
:: Best Way To Beat Sugar Addiction : The 21 Day Sugar Detox Manual From Balanced Bites. Help Break Your Addiction To Sugar 24. Help Break Your Addiction To Sugar 24. Tuesday, December 4, 2012. :: Best Way To Beat Sugar Addiction : The 21 Day Sugar Detox Manual From Balanced Bites. Best Way To Beat Sugar Addiction This Is An Easy-to-follow Three Week Program To Help Break Your Addiction To Sugar And Carbs. Includes Over 90-pages In The Program Guide, Supplement Guide, & Faqs Guide. Great For Low-carb, Primal Or Paleo Diets Or Simply The Transition. Best Way To Beat Sugar Addiction Do Omni Detox Drinks Work How Long Does Alcohol Detox Take At Home Is Cranberry Juice Good For A Detox Yogurt For Detox Sugar Addiction Glutamine Candida Sugar Addiction Long Term Effects Of Sugar Addiction Detox Apple Cinnamon Water Recipe Look Out For Detox A Low Sugar Diet What Is A Healing Crisis Detox Reaction What Is The 21 Day Detox After Reiki Detox For Sugar Addiction Sugar Addiction Help Uk How Good Are Detox Diets Sugar D...
*  :: Drinking Distilled Water For Detox : The 21 Day Sugar Detox Manual From Balanced Bites | Help Bre
:: Drinking Distilled Water For Detox : The 21 Day Sugar Detox Manual From Balanced Bites. Help Break Your Addiction To Sugar 19. Help Break Your Addiction To Sugar 19. :: Drinking Distilled Water For Detox : The 21 Day Sugar Detox Manual From Balanced Bites. Drinking Distilled Water For Detox This Is An Easy-to-follow Three Week Program To Help Break Your Addiction To Sugar And Carbs. Includes Over 90-pages In The Program Guide, Supplement Guide, & Faqs Guide. Great For Low-carb, Primal Or Paleo Diets Or Simply The Transition. Drinking Distilled Water For Detox Do Omni Detox Drinks Work How Long Does Alcohol Detox Take At Home Is Cranberry Juice Good For A Detox Yogurt For Detox Sugar Addiction Glutamine Candida Sugar Addiction Long Term Effects Of Sugar Addiction Detox Apple Cinnamon Water Recipe Look Out For Detox A Low Sugar Diet What Is A Healing Crisis Detox Reaction What Is The 21 Day Detox After Reiki Detox For Sugar Addiction Sugar Addiction Help Uk How Good Are Detox Diets Sugar Diet Acne What Is Ni...
*  :: Does A Detox Make You Tired : The 21 Day Sugar Detox Manual From Balanced Bites | Help Break Your
:: Does A Detox Make You Tired : The 21 Day Sugar Detox Manual From Balanced Bites. Help Break Your Addiction To Sugar 19. Help Break Your Addiction To Sugar 19. Friday, August 17, 2012. :: Does A Detox Make You Tired : The 21 Day Sugar Detox Manual From Balanced Bites. Does A Detox Make You Tired This Is An Easy-to-follow Three Week Program To Help Break Your Addiction To Sugar And Carbs. Includes Over 90-pages In The Program Guide, Supplement Guide, & Faqs Guide. Great For Low-carb, Primal Or Paleo Diets Or Simply The Transition. Does A Detox Make You Tired Do Omni Detox Drinks Work How Long Does Alcohol Detox Take At Home Is Cranberry Juice Good For A Detox Yogurt For Detox Sugar Addiction Glutamine Candida Sugar Addiction Long Term Effects Of Sugar Addiction Detox Apple Cinnamon Water Recipe Look Out For Detox A Low Sugar Diet What Is A Healing Crisis Detox Reaction What Is The 21 Day Detox After Reiki Detox For Sugar Addiction Sugar Addiction Help Uk How Good Are Detox Diets Sugar Diet Acne What Is Nina ...
*  No sugar for a year produces sweet results
... Sign in with Facebook Sign in with Google Sign In FAQ. Sign in with Facebook Sign in with Google Sign in FAQ. Facebook Email. No sugar for a year produces sweet results. There are plenty of reasons for American families to put the brakes on sugar consumption. Type 2 diabetes, heart disease, and other obesity-related medical conditions have all been linked to a diet overloaded with the sweet stuff. No sugar for a year produces sweet results There are plenty of reasons for American families to put the brakes on sugar consumption. Type 2 diabetes, heart disease, and other obesity-related medical conditions have all been linked to a diet overloaded with the sweet stuff. This story is part of Health and Wellness. Communities try to make a difference through collaboration on health. Houston tries to slim down with food, fitness. No sugar for a year produces sweet results. Greta Schaub, 13, takes a bite out of vegetable pizza made with no-sugar tomato sauce during her family's year of no added su...
Publication request: EFFECT OF SUCROSE CONCENTRATION ON CARBOHYDRATE METABOLISM IN BEMISIA ARGENTIFOLII: BIOCHEMICAL MECHANISM AND PHYSIOLOGICAL ROLE FOR TREHALULOSE SYNTHESIS IN THE SILVERLEAF WHITEFLY ARS : Research. ARS Office of International Research Programs. Title: EFFECT OF SUCROSE CONCENTRATION ON CARBOHYDRATE METABOLISM IN BEMISIA ARGENTIFOLII: BIOCHEMICAL MECHANISM AND PHYSIOLOGICAL ROLE FOR TREHALULOSE SYNTHESIS IN THE SILVERLEAF WHITEFLY Authors. Because of the high sugar content of plant sap, sugar is in excess and some must be excreted in the form of a sugary mixture called honeydew. In this study we examined the effect of sucrose concentration on its uptake and metabolism by the silverleaf whitefly. However, when sucrose was in excess, the whiteflies converted it to an unusual sugar called trehalulose. Technical Abstract: Uptake and metabolism of sucrose by silverleaf whiteflies Bemisia argentifolii was investigated on diets containing 3 to 30% sucrose. At an optimal pH of 7, the volume of liq...
*  TCA precipitation from High% sucrose solutions - Protein and Proteomics - BioForum
... Google Sign in options. Remember me This is not recommended for shared computers Sign in anonymously Don't add me to the active users list Privacy Policy. Sign In. Forums. Forums. BioForum. Protocols and Techniques Forums. Protein and Proteomics. Javascript Disabled Detected You currently have javascript disabled. TCA precipitation from High% sucrose solutions Started by. 1 reply to this topic #1. member Active Members. Posted 05 May 2010 - 10:25 AM I am attempting to precipitate protein from fractions of a sucrose gradient. My technique has been: -Add TCA to 14%. Is there something I can change to increase the efficiency. My other concern is that I absolutely MUST be getting equal efficiency of precipitation at the whole range of sucrose concentrations 2.5 - 55%. Does anyone think that the high sucrose concentration would cause a problem... I HAVE noticed that BSA in particular seems to precipitate with less efficiency at higher sucrose concentrations... but some other proteins don't appear to be af...
*  Preparation of sucrose esters by interesterification - Springer
... Search Help. Contact Us. Find out how to access preview-only content. Journal of the American Oil Chemists Society February 1970, Volume 47, Issue 2, pp 56-60 First online:. Preparation of sucrose esters by interesterification. R O Feuge. Affiliated with Southern Regional Research Laboratory. J Zeringue Jr. Affiliated with Southern Regional Research Laboratory. J Weiss. Affiliated with Southern Regional Research Laboratory., Mona Brown. Affiliated with Southern Regional Research Laboratory. The solvent-free interesterification of molten sucrose and fatty acid esters at temperatures between 170–187 C has now been performed with the aid of lithium, sodium and potassium soaps as catalysts and solubilizers. No sucrose esters were obtained with lithium palmitate, while the yield with lithium oleate was among the best, but consisted of over 90% tetra- and higher esters of sucrose. Lower esters were best produced with combinations of lithium oleate with sodium or potassium oleate employed at a level of about 25...
*  The Blood Sugar Solution 10-Day Detox Diet - Hachette Book Group
... The Blood Sugar Solution 10-Day Detox Diet Activate Your Body's Natural Ability to Burn Fat and Lose Weight Fast By Mark Hyman MD Hardcover Book, 2014. Hyman's revolutionary weight-loss program, based on the #1 New York Times bestseller The Blood Sugar Solution, supercharged for immediate results. Hyman's groundbreaking Blood Sugar Solution program, THE BLOOD SUGAR SOLUTION 10-DAY DETOX DIET presents strategies for reducing insulin levels and producing fast and sustained weight loss. Format: Hardcover Book Price: $30.00 US/$33.00 CAN ISBN-13: 9780316240000 On Sale Date: 02/25/2014 Publisher: Little, Brown and Company Imprint: Little, Brown and Company Full Details. Formats Available: Hardcover Book, Trade Paperback, Electronic Book, Audiobook, Audiobook, Hardcover Book. Hyman's groundbreaking Blood Sugar Solution program, THE BLOOD SUGAR SOLUTION 10-DAY DETOX DIET presents strategies for reducing insulin levels and producing fast and sustained weight loss. He is the #1 New York Times bestselling auth...
*  "Effect of Sucrose Esters and Sunflower Oil Addition on Microstructure " by Silvana Martini, M. C.
"Effect of Sucrose Esters and Sunflower Oil Addition on Microstructure " by Silvana Martini, M. C Puppo et al. Search. Browse Collections. My Account. Digital Commons Network™. Skip to main content. USU Home A-Z Index. DigitalCommons@USU. Contact Us. Author Gallery. Academic Disciplines. Agriculture and Applied Sciences. Nutrition, Dietetics, and Food Sciences. NFS_FACPUB. NFS Faculty Publications. Title. Effect of Sucrose Esters and Sunflower Oil Addition on Microstructure of a High-Melting Milk Fat Fractions. Authors. Silvana Martini , Utah State University Follow M. C Puppo R. W Hartel M. L Herrera. Document Type. Journal/Book Title/Conference. Journal of Food Science. The effects of sunflower oil SFO and the sucrose esters SE P-1670, P-170, and S-170 on crystalline microstructure of a high-melting milk fat fraction HMF was studied by polarized-light microscopy PLM and confocal laser scanning microsopy CLSM. The addition of SFO markedly diminished crystal size and delayed crystallization kinetics, as obser...
*  A Comparison of the Water Potential of Potato and Sweet Potato Tubers :: Biology Lab Report
* Overall I believe that sweet potato will have a heavier end mass then that of normal potato because the normal potato will have a higher water potential and therefore lose mass when in solutions of a high sucrose concentration. Sweet Potato Table of Results 1 Start mass g end mass g Change in mass g Change of mass in % 1 molar sucrose solution 1.53 1.49 -0.04 -2.61 0.75 molar sucrose solution 1.91 1.90 -0.01 -0.52 0.5 molar sucrose solution 1.77 1.99 +0.22 +11.11 0.25 molar sucrose solution 1.82 2.17 +0.35 +16.13 Distilled water solution 1.70 2.18 +0.48 +22.02 Potato Table of Results 1 Start mass g end mass g Change in mass g Change of mass in % 1 molar sucrose solution 2.81 1.99 -0.82 -29.29 0.75 molar sucrose solution 3.22 2.50 -0.72 -22.47 0.5 molar sucrose solution 3.29 2.78 -0.51 -15.50 0.25 molar sucrose solution 3.18 3.39 +0.21 +6.60 Distilled water solution 2.78 3.05 +0.27 +9.71 Sweet Potato Table of Results 2 Start mass g End mass g Change in mass g Change of mass in % 1 molar sucrose solution 1.02...
*  The Effect Of Concentration Gradient On Osmosis Biology Essay
I expect that when there is a high concentration of sucrose the water molecules from inside the potato section will go away from the potato and set off into the sucrose. In addition, as the quantity of sucrose in the solution increases the potato piece will get smaller more and as the quantity of distilled water increases in the solution, the potato piece will become turgid. The potato core to be entirely covered in the sucrose solution is too another very important part in order to make the experiment as fair as achievable. Because if the potato core is not entirely covered by the sucrose solution, the outcome of osmosis will not take place to its fullest and I would obtain dissimilar readings of the mass for each potato core, which will also make the test unreasonable. For that reason, I will use 10cm of every concentration of solution for each potatoes core. E.g., one potato core can be placed in a test tube of 10ml of 0.50M of sugar solution and one potato core can be put in a test tube of 25ml of 0.50M o...
*  Sucrose gap
The 'sucrose gap' technique is used to create a conduction block in nerve or muscle fibers. Double Sucrose Gap Technique. The method was used to study action potentials in nerve fibers. Alix who introduced an improved chamber for the double sucrose gap with voltage clamp technique which eliminated external resistance from the node. This chamber contains an isotonic sucrose solution of a high specific resistance. Specific resistance describes the ability of a material or solution to oppose electric current, so a sucrose solution of a high specific resistance is effective in electrically isolating the three chambers. Single Sucrose Gap Technique. It is useful in the study of small nerve fibers and electrically connected cells such as smooth muscle cell. The method creates conduction block in a nerve or muscle fiber by introducing a gap of high resistance between two groups of cells. Double Sucrose Gap Technique. Two chambers containing sucrose solutions are used to isolate a node of the nerve or tissue, which i...
*  Oral Sucrose Associated With Decreased Discomfort During Newborn Screening | Largo Medical Center |
Oral Sucrose Associated With Decreased Discomfort During Newborn Screening. Largo Medical Center. Largo, FL. Patients & Visitors. Patients & Visitors Patients & Visitors. H2U - health to you. Patient Portal. Pay Bill Online. Health Info. Health Info Health Info. Health Library. Video Library. Careers. For Medical Staff. Hospital Affiliation Letters for Medical Center Staff. Hospital Information. Hospital Leadership. Patients & Visitors. Patients & Visitors Classes Events. H2U - health to you. News World Report - Best Hospital Edition Quality standards and exclusive rankings earn Largo Medical Center a spot in the 2015 Best Hospital edition of U.S. Largo Medical Center @LargoMedical RT @tobaccofreefla: Smoking damages nearly every organ in the body. Oral Sucrose Associated With Decreased Discomfort During Newborn Screening. 2 milliliters of 24% sucrose solution, administered by mouth using a syringe over 1 to 2 minutes 1 gram of liposomal lidocaine 4% cream to the dorsum of the hand Both sucrose and lidocaine ...
*  Diabetics – Blood Sugar Solution | Mark's Daily Apple Health and Fitness Forum page
Diabetics – Blood Sugar Solution. Mark's Daily Apple Health and Fitness Forum page. New Posts. Today's Posts. Diabetics – Blood Sugar Solution. Thread: Diabetics – Blood Sugar Solution page. TorMag Senior Member. Join Date Jan 2011 Location Johns Creek, GA Posts 559. Diabetics – Blood Sugar Solution. All, I have been Primal now for almost 1 year, Sept 5 will be my Primal Birthday, as of today I have dropped 94 lbs. I am a Type two diabetic. Unlike a lot of Type II’s who have gone Primal, I have not been “Cured” of my diabetes, in fact, I have gotten worse. After reading Mark’s book, I decided to take myself off of insulin, staying on the oral medications that I was taking. I mentioned going back on insulin two weeks ago on another thread when someone mentioned to me to check out the Blood Sugar Solution book by Dr. Hyman. Hyman has a six week plan to “cure” you of Type II diabetes. Hyman’s Solution is basically Whole 30 with a bunch of supplements. I Kettlebell therefore I am. My Journal My Journal. Reply Wit...
*  How many grams of sucrose (C12H22O11) must be dissolved
How many grams of sucrose C12H22O11 must be dissolved. Tuesday October 6, 2015 School Subjects Art. Business. Computers. English. Foreign Languages. Health. Home Economics. Math. Music. Physical Education. Science. Social Studies. Grade Levels Preschool. Kindergarten. Elementary School. 1st Grade. 2nd Grade. 3rd Grade. 4th Grade. 5th Grade. 6th Grade. 7th Grade. 8th Grade. High School. 9th Grade. 10th Grade. 11th Grade. 12th Grade. College. Adult Education. Post a New Question. Current Questions. Homework Help : chemistry Posted by cheri on Sunday, September 16, 2012 at 10:40pm. How many grams of sucrose C12H22O11 must be dissolved in 200 g water to make a solution in which the mole fraction of su- crose is 0.1. Answer in units of g chemistry - DrBob222, Sunday, September 16, 2012 at 10:59pm 200 g H2O is how many mols. That's g/molar mass. total mol = n sucrose + n H2O n sucrose = grams/molar mass sucrose. = 0.1 Substitute grams/molar mass for n sucrose and solve for grams. chemistry - cheri, Sunday, Septembe...
*  Sucrose synthase
... image sucrose synthase s png in enzymology a sucrose synthase is an enzyme that catalyzes the chemical reaction ndp glucose d fructose rightleftharpoons ndp sucrose thus the two substrates of this enzyme are ndp glucose and d fructose whereas its two products are ndp and sucrose this enzyme belongs to the family of glycosyltransferase s specifically the hexosyltransferases the systematic name of this enzyme class is ndp glucose d fructose alpha d glucosyltransferase other names in common use include udpglucose fructose glucosyltransferase sucrose synthetase sucrose udp glucosyltransferase sucrose uridine diphosphate glucosyltransferase and uridine diphosphoglucose fructose glucosyltransferase this enzyme participates in starch and sucrose metabolism references category ec...
*  Sucrose intolerance
... Name = Sucrose intolerance. ICD10 =. ICD9 = {{ICD9|271.3}}. ICDO =. eMedicineSubj =. MeshID = }} 'Sucrose intolerance', also called 'congenital sucrase-isomaltase deficiency' CSID. or 'sucrase-isomaltase deficiency',. 2 is the condition in which sucrase, an enzyme needed for proper metabolism of sucrose sugar, is not produced in the small intestine. It is common among the Inupiat people. 3 Overview Signs and Symptoms of Sucrose Intolerance See also References External links. Overview. Sucrose also known as 'saccharose' is a disaccharide and is a two-sugar chain composed of glucose and fructose which are bonded together. In most cases, sucrose intolerance is an autosomal recessive, genetic, metabolic disease, and involves deficiency in the enzyme sucrase, which breaks apart the glucose and fructose molecules. Monosaccharides, or single sugar units, are absorbed directly into the blood. When disaccharides are consumed, they must be broken down into monosaccharides by enzymes in the intestines before they c...
*  hfcs vs liquid sucrose vs invert liquid sucrose
... Forum. Mark Forums Read. Forum. hfcs vs liquid sucrose vs invert liquid sucrose. Thread: hfcs vs liquid sucrose vs invert liquid sucrose. 01-26-2009, 04:19 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. hfcs vs liquid sucrose vs invert liquid sucrose O.K. Reply With Quote. 01-26-2009, 08:54 PM. Ian. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,391. Ian Steppler Canadian Beekeeper's Blog Reply With Quote. 01-26-2009, 11:43 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. Reply With Quote. Ian. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,391. Ian Steppler Canadian Beekeeper's Blog Reply With Quote. jean-marc. View Profile. View Forum Posts. Private Message....
*  hfcs vs liquid sucrose vs invert liquid sucrose
... Forum. Mark Forums Read. Forum. hfcs vs liquid sucrose vs invert liquid sucrose. Thread: hfcs vs liquid sucrose vs invert liquid sucrose. 01-26-2009, 04:19 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. hfcs vs liquid sucrose vs invert liquid sucrose O.K. Reply With Quote. 01-26-2009, 08:54 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,390. Ian Steppler Canadian Beekeeper's Blog Reply With Quote. 01-26-2009, 11:43 PM. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Sep 2001 Location davis, IL Posts 812. Reply With Quote. View Profile. View Forum Posts. Private Message. Visit Homepage. Join Date Jan 2003 Location Manitoba Canada Posts 7,390. Ian Steppler Canadian Beekeeper's Blog Reply With Quote. jean-marc. View Profile. View Forum Posts. Private Message. Join Date...
*  ARS | Publication request: Rapid colorimetric microplate assay for determining glucose and sucrose c
ARS. Publication request: Rapid colorimetric microplate assay for determining glucose and sucrose content in potato tubers ARS : Research. ARS Home. About ARS. International Programs. Find an office at headquarters. Site Map. Related Topics Programs and Projects. ARS National Programs. ARS Office of International Research Programs. ARS Office of International Research Programs Regional Contacts. Title: Rapid colorimetric microplate assay for determining glucose and sucrose content in potato tubers Authors. Submitted to: Potato Association of America Proceedings Publication Type: Abstract Only Publication Acceptance Date: July 27, 2007 Publication Date: August 12, 2007 Citation: Bethke, P.C., Busse, J.S. Rapid colorimetric microplate assay for determining glucose and sucrose content in potato tubers. Potato Association of America Proceedings 91st meeting. Technical Abstract: Accurate quantification of tuber glucose and sucrose content is important for scientific as well as commercial purposes. High pressure li...
*  Sucrose 6F-alpha-galactosyltransferase
sucrose f alpha galactosyltransferase sucrose f alpha galactosyltransferase in enzymology a sucrose f alpha galactosyltransferase is an enzyme that catalyzes the chemical reaction udp galactose sucrose rightleftharpoons udp f alpha d galactosylsucrose thus the two substrates of this enzyme are udp galactose and sucrose whereas its two products are udp and f alpha d galactosylsucrose this enzyme belongs to the family of glycosyltransferase s specifically the hexosyltransferases the systematic name of this enzyme class is udp galactose sucrose f alpha d galactosyltransferase other names in common use include uridine diphosphogalactose sucrose f alpha galactosyltransferase udpgalactose sucrose fru alpha galactosyltransferase and sucrose f alpha galactotransferase references category ec category enzymes of unknown structure...
*  Prenulin lowers circulating glucose and insulin levels after acute oral sucrose challenge. - Nu
... This might limit your experience on this website. SUBSCRIBE. FREE NEWSLETTER. Breaking News on Supplements & Nutrition - North America EU edition. Manufacturers. Research. Markets. Regulation. People. Site Archive. Product claims. Omega-3. Health. Blood sugar management. Bone & joint health. Cancer risk reduction. Cardiovascular health. Eye health. Gut/digestive health. Healthy aging. Maternal & infant health. Men's health. Oral/gum health. Respiratory health. Skin health. Sports nutrition. Weight management. Women's health. Resources. All Products. Product Brochures. Ingredients. Antioxidants/carotenoids. Botanicals & Herbals. Dairy-based ingredients. Dosage forms & delivery formats. Fibers & carbohydrates. Minerals. Nutricosmetics. Omega-3s & Nutritional oils. Probiotics & prebiotics. Proteins, peptides, amino acids. Soy-based ingredients. Vitamins & premixes. Resources. All Products. Supplier Webinars. Videos Audio. Technical Papers. Product Brochures. Suppliers. Events. Food Jo...
*  Effects of Sucrose on the Extracellular Matrix of Plaque-Like Biofilm Formed in vivo, Studied by Pro
In the ECM of PLB formed under sucrose exposure, the following changes compared with the control PLB were observed: 1 the presence of upregulated proteins that may be involved in bacterial response to environmental changes induced by sucrose and 2 the absence of calcium-binding proteins that may partly explain the low inorganic concentration found in ECM of PLB formed under sucrose exposure. Therefore, the absence of calcium-binding proteins in the ECM of PLB formed under exposure to sucrose ta- Table 2. Thus, the presence of calcium-binding pro- teins, exclusively in ECM of the PLB formed in the ab- sence of sucrose, supports the view that these proteins, in addition to plaque Ca binding, may act as organic mineral reservoirs in PLB....
*  Sucrose octaacetate
... chembox watchedfields changed verifiedrevid imagefile sucrose octaacetate png imagesize iupacname acetic acid s s r r acetoxy bis acetoxymethyl r r s r r triacetoxy acetoxymethyl tetrahydropyranyl oxy tetrahydrofuranyl ester othernames section chembox identifiers casno ref casno pubchem smiles cc o oc o o o coc o c oc o c oc o c coc o c oc o c oc o c oc o c section chembox properties formula c h o molarmass g mol appearance needles density g cm at c meltingptc boilingptc boilingpt notes at mmhg solubility slightly soluble in water solubleother soluble in ethanol diethyl ether acetone benzene chloroform section chembox hazards mainhazards flashpt autoignitionpt sucrose octaacetate is an acetylated derivative of sucrose it is used commercially and industrially in a variety of applications it is used as an inert ingredient in pesticide s and herbicide s as of december sucrose octaacetate was determined by the epa to be usable as an inert ingredient in pesticides due to its low toxicity sucrose octaacetate h...
*  BISC110: Series 4 Lab 11 Enzymology - OpenWetWare
When yeast cells are grown in YEP+2% glucose, the transcription of genes for enzymes that are needed to break down sugars other than glucose is repressed, so those enzymes are not produced within the cell. Using this assay you will determine the amount of invertase produced by normal, "wild type" yeast grown in YEP+2% glucose normal glucose medium and in YEP+0.05% glucose minimal glucose medium. However, the mutants should grow almost as well as the wild type cells on YEP+2% glucose. Based on genetic regulation of invertase production by glucose repression, form a hypothesis about the relative amounts of invertase that the wild type and mutant strains of yeast will make when grown in media containing 2% glucose or in 0.05% glucose. You will use DNS reagent to assay the activity of both purified invertase and any invertase that has been produced by the two yeast strains grown in either 2% or 0.05% glucose. To test the purified invertase indirectly, you will add some to a solution of sucrose, allow time for the...
*  [IAEP] Sucrose 0.83.6 in Soas
sucrose in soas sucrose in soas simon schampijer simon at schampijer de tue feb est previous message sucrose in soas next message mediawiki messages sorted by tomeu vizoso wrote on tue feb at simon schampijer simon at schampijer de wrote hi sucrose the release candidate has find it s way into sugar on a stick get the latest image at http download sugarlabs org soas snapshots soas iso does it work in xos regards tomeu no we have a kernel issue bernie has pinged the right people that needs to be fixed first to be able to build xo images cheers simon previous message sucrose in soas next message mediawiki messages sorted by more information about the iaep mailing list...
*  Exercise 6.9 - Chemical Composition of Myelin
... LEVEL III. Materials. Calf brain 10 0.25 M sucrose 0.88 M sucrose Blender or tissue homogenizer Refrigerated centrifuge. Procedure. Homogenize 100 gms of calf brain in 0.25 M sucrose to make a 10% brei. Centrifuge the homogenate at 500 xg for 10 minutes at 4° C. Collect the supernatant and recentrifuge the supernatant at 11,000 xg for 10 minutes. 11. Discard the supernatant and resuspend the pellet in 10 ml. of 0.25 M sucrose. Carefully add 25 ml of 0.88 M sucrose to the bottom of the tube, so that the resuspended pellet lies on top of the sucrose. Centrifuge at 11,000 xg for 10 minutes to separate the mitochondria from the myelin vessicles. The myelin will float on the surface, while the denser mitochondria should pellet at the bottom of the tube. Carefully remove the upper myelin vessicle layer. Return to Table of Contents. Cell Biology Laboratory Manual. Dr. William H. Heidcamp, Biology Department, Gustavus Adolphus College, St. Peter, MN 56082 --
*  KEGG T01064: Dsec GM20028
Pentose and glucuronate interconversions. Ascorbate and aldarate metabolism. Starch and sucrose metabolism. Porphyrin and chlorophyll metabolism. Drug metabolism - other enzymes. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00040 Pentose and glucuronate interconversions Dsec GM20028 00053 Ascorbate and aldarate metabolism Dsec GM20028 00500 Starch and sucrose metabolism Dsec GM20028 Metabolism of cofactors and vitamins 00830 Retinol metabolism Dsec GM20028 00860 Porphyrin and chlorophyll metabolism Dsec GM20028 Xenobiotics biodegradation and metabolism 00980 Metabolism of xenobiotics by cytochrome P450 Dsec GM20028 00982 Drug metabolism - cytochrome P450 Dsec GM20028 00983 Drug metabolism - other enzymes Dsec GM20028 Enzymes 2. AA seq 397 aa. +upstream nt +downstream nt atgtatctactcttaaatggcctggatgtgatggtcacttcacaggctgatctgctaaag gatccgagattccaacgcgttttccagaccaaattcgatttgatgatattgggctcgttt ttcaacgactttaaattgggagttgctggcaagctgaaggtacccgtaatagtcgactgg atgatgctgtcgaacaccatgatcgatgagtttgtggccaatccct...
*  KEGG T00582: RBAM 025880
Bacillus methylotrophicus FZB42: RBAM_025880. Entry RBAM_025880 CDS T00582. Gene name ysdC. Definition RefSeq hypothetical protein. KO K01179. endoglucanase. Organism bay Bacillus methylotrophicus FZB42. Pathway bay00500. Starch and sucrose metabolism. bay01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism RBAM_025880 ysdC Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds cellulase RBAM_025880 ysdC. Position complement 2713678..2714763. AA seq 361 aa. NT seq 1086 nt. +upstream nt +downstream nt atgacaaaattagatgaaacgctcaccatgctgaaagcgttaacggatgcaaaagggata ccgggaaatgagagagaagtaagacaagtgatgaaatcatacatagaaccatttgccgat gatgtcacaacagaccggctgggaagcttaatcgccaaaaaaacgggcaaagaaaacggt ccgaaaatcatgatctcagggcatttagatgaagtcggttttatggtgacgcaaatcact gataaaggctttctccgctttcaaaccgtcggcggctggtggtctcaggtcatgctggcc cagcgcgtcaccgtcgtgacaaaaaaaggggacatcacggggatcatcggttcgaaaccg cctcacattctgcct...
*  KEGG T01388: Tmar 1690
Thermaerobacter marianensis: Tmar 1690. Entry Tmar 1690 CDS T01388. Definition RefSeq peptidase M42 family protein EC: endoglucanase. Organism tmr Thermaerobacter marianensis. Pathway tmr00500. Starch and sucrose metabolism. tmr01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Tmar 1690 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds cellulase Tmar 1690. Position complement 2028917..2030074. AA seq 385 aa. NT seq 1158 nt. +upstream nt +downstream nt atggcgaccccagctgagcaggccggagggcagcccggcgtcccggccggtggacaggcc ggcggcgagtcacgtctgatcggtttcctccgcgacctgacccagacctacggcccctcg ggccgggaagacgcggtgcgcgagtacatccgcgcccggatcgaaccgtgggcggacgaa gtgcgcgtcgacgccctgggcaacttgatcgcccggcgcgcgccgcgggggaccggggcg gatgcggccggtcccggcacccctgcagccgccgggtccgcaggaggtgccgaggggcct gggggccgcggggccggccggcgcatcatgatcgctgcccatatggacgagatcgccgtc atcgccacccacatcgacgacaagggcttcatccgcgtggagcccgtgg...
*  KEGG T01403: Psesu 1585
... Pseudoxanthomonas suwonensis: Psesu 1585. Entry Psesu 1585 CDS T01403. Definition RefSeq glycoside hydrolase family protein. KO K01179. endoglucanase. Organism psu Pseudoxanthomonas suwonensis. Pathway psu00500. Starch and sucrose metabolism. psu01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Psesu 1585 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds cellulase Psesu 1585. SSDB. Motif Pfam: Cellulase. Other DBs NCBI-ProteinID: ADV27430 NCBI-GI: 319787186 NCBI-GeneID: 10123157 JGI: Psesu 1585 UniProt: E6WTD1. Position complement 1750757..1751776. AA seq 339 aa. MSRTTLLAGLCLGLMALLPNAMAADPRPLSAADQVARMGAGVNVLGYDPYWKAGEQGNYR EEHFAKIREAGFGTVRVALFTFPHLDEANRLDPQWLAKLDQVIGWGTGNGLQVILDVHDF NDCVKDVPACEVKLEQVWTQLGERYAGQPDQVVFELLNEPHGALDAKAWNGLFAKLLEVV RRTNPTRNVVVGPTRWNNLEELDTLQLPEDDRHLIVTFHYYEPFAFTHQGASWVEPQFSE KTGVRFNTPGQVAKIESDFDKVKAWSRKHDRPILLGEYGAYDKAPMEDRVYWTRTVARAA...
*  KEGG T01603: Halar 2192
... Halophilic archaeon: Halar 2192. Entry Halar 2192 CDS T01603. Definition GenBank Cellulase EC: KO K01179. endoglucanase. Organism hah Halophilic archaeon. Pathway hah00500. Starch and sucrose metabolism. hah01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Halar 2192 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds cellulase Halar 2192. SSDB. Motif Pfam: Peptidase M42. Other DBs NCBI-ProteinID: AEN05873 JGI: Halar 2192 UniProt: G2MM46. Position complement 1431209..1432276. AA seq 355 aa. MQTPQREFLDALLTTPSPSGFETRGQRVWVDYVSQFADRVETDAYGNAVAIHEGDPDEDT EFAVGGHADEIGFIVRDITDEGFLRIARVGGSDRTVSKGQHVTVHTDEGPVQGVIGQTAI HLREQGKEEYEEIAEQFVDIGATDDEDAKELVTIGDPATFSSGIQELKGSRVAARGMDNR TGTWVAAETLRRASEAGAAATVVAVSTVQEEVGLKGAQMVGYDLDPDAFIAVDVTHATDN PDVAGKNRGPVKLSEGPVVGRGSANHPALVDLAREAADADDVDHQFQAAGSGTGTDADGV FTERGGIPSLNVSIPNRYMHTPVEVVDLEDLDAVADLCVGMAERAAEDAPFGVDI. NT seq 106...
*  KEGG T00914: Kole 0040
... Kosmotoga olearia: Kole 0040. Entry Kole 0040 CDS T00914. Definition RefSeq peptidase M42 family protein. KO K01179. endoglucanase. Organism kol Kosmotoga olearia. Pathway kol00500. Starch and sucrose metabolism. kol01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Kole 0040 Enzymes 3. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds cellulase Kole 0040. SSDB. Motif Pfam: Peptidase M42 Peptidase M20 Peptidase M28 Peptidase M18. Other DBs NCBI-ProteinID: ACR78769 NCBI-GI: 239616451 NCBI-GeneID: 7968865 JGI: Kole 0040 UniProt: C5CHD0. Position complement 46655..47677. AA seq 340 aa. MKTPELLIKLSNAFGPVGYEDEVRKIIQEEIEPYVDEVKVDNLGNLIAFKRGTGKKKVAF FAHIDEVSLVVSAKDERGFLRFDTMGGIDPKVLIAQRVKVVSKDGKVRRGVIGVLAPHLQ KAADRKNIPPMDEMFIDVSMNPDYEKIEIGDLVVIDTEAFESNGKVIGKALDDRACAVIS ILVAKQLSKFSRFPDVYFVFTSREEVGGMGARVAAEAIQPDVGIAMDVTHAHKRTGIELG KGPAITVGGPNIHKGYFKMLDDVAKREGVKVQYEIAAGRTGTDADNVQIAGT...
*  KEGG T02381: Deipe 3548
Entry Deipe 3548 CDS T02381. Organism dpd Deinococcus peraridilitoris. Starch and sucrose metabolism. dpd01100. Metabolic pathways. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Deipe 3548 Enzymes 2. AA seq 500 aa. NT seq 1503 nt. +upstream nt +downstream nt atgacgcggtccagtggcgttctgctgcacctgacttcgctgcccggaccgtacggcata ggagaattcaatgagcacgcatatgcctgcgtcgactggcttgctcgggccggacagcag tactggcaggtgatgccgcttggcccgaccggctacggcgacagcccctatcagtcattc agtgcgtttgccggcaatccatacctgatttcactggacgccctgcggcgcgacggcctg ctgagcgatcaggatctgtccggtcatccagacttcgaccacgaccgtgttgatttcggc gtgcagtacacgtggcgcaatggggtgttgcgccgcgccttcgagcacttcgaggcgggc gctggcgcggggttgacgggcgacttccaggccttttgcgaagccgaggccgcctggctc gacgattacgcgttgttcatggccctcaaggatgcgcatggtggacgggcctggaatgaa tgggaccgcgagatccgcacccggcaaagtgcggcaatggccgcgtggcgcgacaagctg gagcgcgaggtgcggctgtacagctttgtgcagtttctgtttttccgtcagtggaacgca ctgcgcgcttacgcccaccagcagggcgtgcagatcatcggcgacattccgatttttgtg gcgatggattcggcggacgcgtgggccaaccccgaccagttttat...
*  KEGG T01867: Ththe16 1275
Organism tts Thermus thermophilus SG0.5JP17-16. Starch and sucrose metabolism. tts01100. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Ththe16 1275 Enzymes 2. Position complement 1226750..1228252. AA seq 500 aa. NT seq 1503 nt. +upstream nt +downstream nt atggagcttccccgcgctttcggcctgcttctccaccccacgagcctccccggcccctac ggcgtcggcgtcctgggccaggaggcccgggacttcctccgcttcctcaaggaggcgggg gggcggtactggcaggtcctccccttgggccccacgggctatggcgactccccctaccag tccttcagcgccttcgccggaaacccctacctcatagacctgaggcccctcgcggagcgg ggctacctgcgcctggaggaccccggcttcccccaaggccgggtggactacggcctcctt tacgcctggaagtggcccgccctgaaggaggccttccggggcttcaaggaaaaggcctcc ccggaggagcgggaggccttcgccgccttccgggagagggaggcctggtggctcgaggac tacgccctcttcatggccctgaaggcccaccacggggggcttccctggaaccggtggccc ctttccctgcggaagcgggaagagaaggcccttagggaggcgaaaagcgccttggccgag gaggtggccttccacgccttcacccagtggctcttcttccgccagtggggggccttgaag gcggaggccgaggcgttgggcatccggatcatcggggacatgcccatcttcgtggccgag gactccgccgaggtctgggcccaccccgagtggtttcacctggacgag...
*  KEGG T01128: Sthe 1074
Entry Sthe 1074 CDS T01128. Organism sti Sphaerobacter thermophilus. Pathway sti00500. Starch and sucrose metabolism. sti01100. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism Sthe 1074 Enzymes 2. AA seq 502 aa. NT seq 1509 nt. +upstream nt +downstream nt gtggtagtgtctggcaggacggcagggatccttcttcacccgacgtcgctcccggggcca catggggtcggggatcttggcgggtcggcggcgcggttcatcgactggctcagcgaggca aggcaaggtctgtggcagatcctgccgctggggcctcccggcgccggggactcgccgtac gacgcgcggtcgtcgtttgcgggcaacccgctgctgatcgcattgtccccgctggtcgag tggggtctgcttaccgccgacgaggtgccgccaccgctgatgtccgacccggagcgtgcc gacttcgccggggcgaccagcgtcaagctgaccgcccttgcgcgggcattcgagcgcttt gaggcaagcggcgatggcgagttgcgcgttgcctatgaggagttctgggagcgggagagg gcctggctggccgattacgcgctctatgctgcgctgcgcacggcgcacgacggcctgccc tggtaccgctgggagccgggcctcgttcggcgcgagcccgcagcacttgccgagtggcgg gcgcggttggaccgtgaggtccgctttcacgccttcctccagttcgtcttcgatcgccag tggaccactctgaagcactacgccaacgagcggggcatccgtatcgtgggggacatcccg atctacgtctcccacgacagtgccgacgtatgggcgcaccaggacctctt...
*  KEGG T01496: SELMODRAFT 123852
Definition RefSeq hypothetical protein. Starch and sucrose metabolism. Brite KEGG Orthology KO Metabolism Carbohydrate metabolism 00500 Starch and sucrose metabolism SELMODRAFT 123852 Enzymes 2. AA seq 540 aa. NT seq 1623 nt. +upstream nt +downstream nt atggtttccagtgctctatcgccgggggatgatttgccagacgagtatgagaaggatgat ccttcaaagaaggccatgcccagaagagctgggattattttgcatcctacttctttgcct ggaccgcatgggattggagaccttggtccagacgcttttagatttctcgattggctcgag tctactggatgtcgcatttggcaggttctgccattggtacctcctgggagaaaagccgga gaggatggatcgccttacgctggacaagatgctaactgcgggaatactcttctgatctcg ctgactgaactcgtcaaagatggtcttctggaagaagaagatattcctgaggctatacct gtcgagaaaattaactatgaagctgtagccgagctcaaggatccattgattcaaaaggct gcaaagaatttggtgcaaaatggaggttctttgaagaaggatctcgaaaattttcgaaag agcccccaaattgcaagctggctggaagaagctgctttatttgcagctatagattcacat ttcgatgacggagcctggtggcaatggccagagcctctgcgagatagaaatccttcggca ctagataaagctcggaaagagcataaagactttattgacgtttttattgcgcaacaattt ttgtttcaaaagcagtggcaagctttgcatacgtacgcaaatgaaagaggaatcaagatt attggcgacatgccgatttacgtaggaggtcatagtgc...
*  [Histonet] Sucrose and paraffin
sucrose and paraffin sucrose and paraffin from molinari betsy hi all i have no experience with ihc but once again had a researcher ask me if placing tissue in sucrose after nbf is helpful in antigen staining thanks betsy betsy molinari ht ascp texas heart institute cardiovascular pathology bertner ave houston tx fax histonet mailing list histonet lists utsouthwestern edu http lists utsouthwestern edu mailman listinfo histonet previous message next message...
*  Sucrose diacetate hexaisobutyrate
... redirect sucrose acetate isobutyrate...
*  Sucrose
... redirect saccharose...
*  File:Sucrose b.gif
file sucrose b gif file sucrose b gif summary not copyrighted no image in the world looks like this delete if it is found elsewhere licensing...
*  Sucrose
... redirect sacarose...
*  [mythtv-users] No Livetv on frontend without backend
2007-04-23 16:16:22.306 MainServer::HandleAnnounce Monitor 2007-04-23 16:16:22.334 adding: sucrose as a client events: 0 2007-04-23 16:16:22.337 MainServer::HandleAnnounce Monitor 2007-04-23 16:16:22.338 adding: sucrose as a client events: 1 2007-04-23 16:16:22.340 Reloading backend settings 2007-04-23 16:16:22.344 Received a remote 'Clear Cache' request 2007-04-23 16:19:54.836 MainServer::HandleAnnounce Monitor 2007-04-23 16:19:54.865 adding: sucrose as a client events: 0 2007-04-23 16:19:54.875 MainServer::HandleAnnounce Monitor 2007-04-23 16:19:54.893 adding: sucrose as a client events: 1 2007-04-23 16:19:54.920 MainServer::HandleAnnounce Playback 2007-04-23 16:19:54.922 adding: sucrose as a client events: 0 2007-04-23 16:19:55.035 TVRec 16 : Changing from None to WatchingLiveTV 2007-04-23 16:19:55.045 TVRec 16 : HW Tuner: 16- 16 2007-04-23 16:19:57.981 Finished recording Who Wants to Be a Millionaire: channel 4081 2007-04-23 16:19:58.084 scheduler: Finished recording: Who Wants to Be a Millionaire: channe...
*  KEGG T03070: CQ11 10440
Starch and sucrose metabolism. Hydrolases 3.2 Glycosylases 3.2.1 Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds alpha-amylase CQ11 10440 5. AA seq 572 aa. +upstream nt +downstream nt gtgactccatcgaacttcgacacacacttcccaggtatctccgaagatccgaactggttc aaaactgccgttttctatgaggtgctcttgcgcgccttcggagattccactgggacgggc ctaggtgacctgcgcggccttatcggccacctagattacctccagtggctcggcgtcgat tgcctgtggatcccgcctttctacccctcccccatgcgcgacggcggttacgacgtctcg aatttcaccgcgatttcacccgaatacggcacgattgaggagttcggcgagctcatcgag caggctcaccggcgtggcatccgcatcatcatcgacctcgtgatcaaccacacctctgac cagcacccgtggttccagtcgtcgcgttctaacccggacggccccttcggagacttctac gtgtggcgcgacgacgacgccgagtacgccgatgcccgcatcatcttcatcgacaccgag gccagcaactggacgttcgatccggtgcgccgccaatacttctggcatcgcttcttctct caccagccggatctcaactatgaaaacccgaaggtgcgcgaggcgatcaaggacgtggtg cgcttttgggccaaactcggaatcgacggcttccgcctcgacgccgtgccctatctgttc gaggaagagggcacgaactgcgaaaatctgcctcgcacccacgcctacctggcagagctg cgcgcgatgttggacgccgaattcccaggcaagatcctgcttgccgaggcgaatcagtgg ccgaacgacgtcgtgga...
*  EC
ec ec redirect sucrose synthase...
*  Granulated sugar
... redirect sucrose white refined...
*  Caster sugar
... redirect sucrose caster...
*  EC
ec ec redirect sucrose phosphatase...
*  Saccharobiose
... redirect sucrose...
*  Carbohydrate loading | Define Carbohydrate loading at
Carbohydrate loading. Define Carbohydrate loading at Word of the Day Translate Games Blog. Apps. Log Out Log In. follow My Account Log Out Log In. Try Our Apps. Word of the Day. Translate. Games. Blog. definitions. definitions synonyms translations. Follow @dictionarycom. follow Pore Over vs. CITE. Translate. Facebook Share. Twitter Tweet. Google+ Share. carbohydrate loading. noun 1. the practice of eating high amounts of carbohydrates, sometimes after a period of low carbohydrate intake, for several days immediately before competing in an athletic event, especially a marathon, in order to store glycogen in the body, thereby providing greater reserves of energy. Unabridged Based on the Random House Dictionary, © Random House, Inc. Cite This Source. carbohydrate loading in Medicine Expand. carbohydrate loading n. A dietary practice that increases carbohydrate reserves in muscle tissue thr... loading?qsrc=2446
*  List of Carbohydrate Foods - IronStruck
... ABOUT Pages IronStruck books Testimonials Product Reviews Advertise HOW TO CONTACT ME. LIST OF CARBOHYDRATE FOODS. Do you know how to tell the difference when you see a list of carbohydrate foods. It s important to know the difference between complex and simple carbohydrates, especially when it comes to athletic performance. It s important to have a list of carbohydrate foods before going on a low or high carbohydrate diet or simple or complex carbohydrate diet. There is a huge difference between the two. It s best to break down carbohydrate foods into two categories. Simple and complex carbohydrates and low and high carbohydrate foods. SIMPLE CARBOHYDRATES. As a rule, simple carbohydrates are easily broken down and quickly enter the bloodstream. This is often why when too many simple carbohydrates are consumed they will cause wild fluctuations in energy levels. Sometimes this is referred to as an energy crash. This is a simple carbohydrate. Here is a list of simple carbohydrates that should be eaten in ...
*  USA Swimming - Carbohydrate Loading for Young Swimmers
... Contact Us. Contact Us. FOR YOU Swimmers. America's Swim Team. Featured Articles. Swimming 101. Coaches. Clinics & Workshops. Clinics & Workshops. National Opportunities. Tips & Training. High Performance Tips. In-Water Training Videos. Coaches In The Know Videos. Strength & Conditioning. Nutrition Center. AT&T Winter Nationals. Speedo Winter Jr Championships. Phillips 66 Nationals. Speedo Junior Nationals. Home / Tips & Training / Nutrition Center / Nutrition Articles Back. By Jill Castle, MS, RDN It s not uncommon to see teams of young swimmers filing into the local Italian restaurant to load up on pasta the night before a big meet. The common conception is that loading up on a high carbohydrate meal will prepare the muscles with a ready source of glycogen stored carbohydrate in the muscle the following day, usually a race day. The problem with the idea of carbohydrate loading in young athletes is that it is an approach based on what we know about the adult metabolism of carbohydrate. Young swimmers an...
*  What are Complex Carbohydrates? (with pictures)
What are Complex Carbohydrates. What are Complex Carbohydrates. Certain vegetables, like peppers, are considered fibrous carbohydrates, which are categorized as complex. Potatoes are a starchy carbohydrate, which is a complex carbohydrate. Broccoli and other fibrous vegetables are complex carbohydrates. Lentils are a type of complex carbohydrate. The fiber in mushrooms is of the fibrous, complex type. Top 10 facts about the world. All carbohydrates are made up of sugar molecules; when three or more of these molecules are bound together, it is considered complex. Complex carbohydrates differ from simple carbohydrates in that simple carbohydrates digest or break down into sugar quickly. Processed foods are the most common source of simple carbohydrates. Potatoes are considered a starchy carbohydrate, which is another type of complex carbohydrate. Most experts recommend reducing simple carbohydrates and increasing complex ones for a healthy, even source of energy throughout the day. Often, people who reduce simp...
*  Anybody heard of "carbohydrate loading?" [Archive] - CavalierTalk: Cavalier King Charles Spaniel B
Anybody heard of carbohydrate loading. General cavalier chat discussion Anybody heard of carbohydrate loading. View Full Version : Anybody heard of carbohydrate loading. arasara 24th January 2007, 06:51 PM. Hi guys ~ 6 more days until Faith comes!. Continental Airlines' consulting Veterinarian recommends that customers shipping small or toy breeds that are less than 12 weeks old and less than 3 lb approx 1.5 kg follow these precautionary steps to ensure their safe transportation: Do not vaccinate these puppies within 3 days of transport Do not worm these puppies within 3 days of transport Ensure that no medical procedures are performed on the puppy within 3 days of transport Use honey or White Karo syrup for carbohydrate loading for the 24-hour period just prior to shipping to help maintain glucose levels in the puppy while in transit. Zippy 24th January 2007, 07:13 PM. :lol: :lol:. arasara 24th January 2007, 07:29 PM. :lol: :lol: He's very excited to have a friend come - he just doesn't understand that she's...
*  Effect of prolonged, submaximal exercise and carbohydrate ingestion on monocyte intracellular cytoki
... ne production in humans - Starkie - 2004 - The Journal of Physiology - Wiley Online Library. The Journal of Physiology. Get New Content Alerts. FIND ISSUES. FIND ARTICLES. You have free access to this content Effect of prolonged, submaximal exercise and carbohydrate ingestion on monocyte intracellular cytokine production in humans. A Febbraio 1,* Article first published online: 12 AUG 2004. The Journal of Physiology. A 2000, Effect of prolonged, submaximal exercise and carbohydrate ingestion on monocyte intracellular cytokine production in humans. The Journal of Physiology, 528: 647 655. 1 Exercise Physiology and Metabolism Laboratory, Department of Physiology, The University of Melbourne, Parkville 3052, Victoria. A Febbraio: Exercise Physiology and Metabolism Laboratory, Department of Physiology, The University of Melbourne, Parkville 3052, Victoria, Australia. Issue published online: 12 AUG 2004 Article first published online: 12 AUG 2004 Received 1 July 2000; accepted 21 July 2000. SEARCH BY CITATION....
*  What Are Complex Carbohydrates? / Nutrition / Carbs
What Are Complex Carbohydrates. / Nutrition / Carbs. Nutrition. Articles Fitness Nutrition. Nutrition. Carbs What Are Complex Carbohydrates. What Are Complex Carbohydrates. And Complex Carbohydrates. Polysaccharide means "many sugars." Polysaccharides, or complex carbohydrates, are several simple sugar molecules linked together. They can be as many as 10,000 simple sugar molecules linked together. Starch and fiber are complex carbohydrates because they are polysaccharides. Simple or Complex. For most people, it's better to choose more complex carbohydrate foods over simple carbohydrate foods. The first reason is that complex carbohydrates usually take longer to be broken down into glucose in your blood, meaning they provide prolonged energy and stabilize your blood sugar rather than spiking it up like simple carbohydrates do. A blood sugar spike, such as one resulting from eating food high in simple carbohydrates like candy, can be bad for your health if it happens too often, which is part of the reason you s...
*  ARS | Publication request: Dietary carbohydrates and cardiovascular disease risk factors in the Fram
Publication request: Dietary carbohydrates and cardiovascular disease risk factors in the Framingham Offspring Cohort ARS : Research. Dietary carbohydrates and cardiovascular disease risk factors in the Framingham Offspring Cohort. Dietary GI was positively associated with fasting triglycerides, fasting insulin, and inversely associated with HDL cholesterol and ISI0,120. Intakes of total carbohydrate were inversely associated with waist circumference and HDL cholesterol, and positively associated with fasting triglycerides. These findings support the hypothesis that a high GI diet unfavorably affects CVD risk factors and therefore, substitution of high with low GI dietary carbohydrates may reduce the risk of CVD. We examined cross-sectional associations between total carbohydrate and dietary glycemic index GI intakes and several cardiovascular disease CVD risk factors in a sample of 2,941 Framingham Offspring Participants. After adjustment for potential confounding factors, dietary GI was positively associate...
*  Rapid carbohydrate loading after a short bout of near maximal-intensity exercise - Murdoch Research
... Repository. Rapid carbohydrate loading after a short bout of near maximal-intensity exercise. Tools Tools Tools. RDF+XML BibTeX RDF+N-Triples JSON RefWorks Dublin Core OAI-ORE Resource Map Atom Format Simple Metadata Refer METS OAI-ORE Resource Map RDF Format HTML Citation ASCII Citation OpenURL ContextObject EndNote MODS OpenURL ContextObject in Span DIDL EP3 XML Reference Manager RDF+N3 Eprints Application Profile. 2002 Rapid carbohydrate loading after a short bout of near maximal-intensity exercise. *Subscription may be required Abstract Purpose: One limitation shared by all published carbohydrate-loading regimens is that 2-6 d are required for the attainment of supranormal muscle glycogen levels. Because high rates of glycogen resynthesis are reported during recovery from exercise of near-maximal intensity and that these rates could in theory allow muscle to attain supranormal glycogen levels in less than 24 h, the purpose of this study was to examine whether a combination of a short bout of high-int...
*  .. A Primer on Dietary Carbohydrates – Part 2 .. A Primer on Dietary Carbohydrates – Part 1 ..
A Primer on Dietary Carbohydrates – Part 2 In a Primer on Dietary Carbohydrates – Part 1, I took a brief look at what carbohydrates are and listed the three primary categories of dietary carbohydrates which are monosaccharides, oligosaccharides and polysaccharides. As well, I looked in some detail at the monosaccharides simple sugars which are glucose dextrose , fructose and galactose. A Primer on Dietary Carbohydrates – Part 1 Having previously done a fairly detailed Primer on Dietary Fats, I wanted to do something similar on the topic of carbohydrates in the future I’ll do one for protein as well. In this article, I’m not going to look at many of the debates surrounding the issues of carbohydrate intake in terms of body weight, body fat, or health , you can read Carbohydrate and Fat Conteroversies Part 1 and Carbohdyrate and Fat Controversies Part 2 for somewhat of an examination of that. Rather, I just want to focus on some basic definitions and concepts since there tends to be a lot of general confusion o...
*  .. Tag Archives: overweight .. High protein beats high carbohydrate diet for biomarkers of metabol
Tag Archives: overweight. Post navigation. ← Older posts. High protein beats high carbohydrate diet for biomarkers of metabolic syndrome. Posted on. March 3, 2013. by. Dr. Jonathan Miller. Reply. Regulating insulin is the key factor metabolic syndrome, diabetes and weight loss. In accordance with that, a randomized controlled trial just published in the journal Diabetes Care offers more evidence that a higher protein with carbohydrate diet improves multiple biomarkers better than a high carbohydrate diet. The authors determined to…. “……study the effects of high-protein versus high-carbohydrate diets on various metabolic end points glucoregulation, oxidative stress, lipid peroxidation, proinflammatory cytokines, adipokines, and resting energy expenditure with high protein–low carbohydrate HP and high carbohydrate–low protein HC diets at baseline and after 6 months of dietary intervention.”. In other words, how does high protein compare with high carbohydrate in the regulation of blood sugar, inflammation, ...
*  » simple carbohydrates
simple carbohydrates. MOVIES. FITNESS. GROOMING. ON LOCATION. GEAR. DRINKS. VICES. GADGETS. DATING. Dating. Fitness. Gadgets. Gear. Grooming. Movies. On Location. Vices. Drink of the Week. Staff Picks - Movies. Entertainment. Grub for Guys. Videos. The dangers of sugar consumption Posted by Bullz-Eye Staff 06/25/2012 @ 8:00 am If you ve been a regular reader of Mike Furci, s Fitness Editor, you ve known for a long time that you should be limiting the amount of sugar and simple carbohydrates in your diet. The dangers of sugar consumption are now getting much more attention, and a recent 60 Minutes story is getting a lot of attention. Sanjay Gupta discusses the dangers of sugar with Dr. Lustig, who explains how many of our health problems like obesity and Type 2 diabetes. His YouTube video, Sugar: The Bitter Truth, has over 2.5 million views. This isn t just about the table sugar you put in your coffee. Most processed foods you buy at the store are loaded with sugars or high fructose corn syrup wh...
*  List of Slow-Release Carbohydrate Foods | Live Well - Jillian Michaels
List of Slow-Release Carbohydrate Foods. Live Well - Jillian Michaels. Jillian Michaels. Sample Fitness Plan. Sample Meal Plan. 25-50 Lbs. Lost. 50-75 Lbs. Lost. 75-100 Lbs. Lost. 100-125 Lbs. Lost. 125+ Lbs. Lost. Live Well. About Jillian. Jillian's Bio. Live Well. Fitness Exercise. List of Slow-Release Carbohydrate Foods. by Gianna Rose. About Gianna Rose. Slow-release carbohydrate foods -- carbs that are absorbed slowly and keep your blood sugar steady -- keep hunger pangs away and help prevent chronic diseases, such as Type 2 diabetes and heart disease. Feel better and stay healthier with slow-release carbohydrates. Whole Grains. Your body digests whole grains more slowly than refined grains, which have been stripped of their bran and germ, and thus fiber, and are absorbed almost as quickly as pure glucose. Quickly absorbed, refined carbohydrates are linked to Type 2 diabetes, heart disease and weight gain, notes the Harvard School of Public Health. Fruits and Vegetables. Most fruits and vegetables are sl...
*  Carbohydrate Loading Keep
... Article submitted by Don Blansett. Carbohydrate Loading Keep. Foreword. The sport of cockfighting has existed for hundreds of years, but like most sciences, more progress has been made in the past fifty than all those preceding years. The average cocks of today could defeat those cocks bred and fed in the 1920's. Why. For the same reasons human beings today are stronger, bigger and faster than their grandparents: breeding and feeding. Great strides have been made in genetics and nutrition in the past fifty, and particularly, the last twenty years. Consequently, average life expectancy, general health, and size have increased by leaps and bounds. In the animal world horses run faster, cows produce more milk and beef, hens lay more eggs, and so on. Cockers of today are more knowledgeable and generally better educated, with more available information, than ever before. But, while most cockers are great students of experience, as a rule, they do little to actually study genetics and nutrition with an eye tow...
*  .. Examples of Simple and Complex Carbohydrates .. Many health experts recommend cutting down or el
Examples of Simple and Complex Carbohydrates. Many health experts recommend cutting down or eliminating sugar and other simple carbohydrates, and increasing the servings of complex carbohydrates in the diet. Unfortunately, over-consumption of sugar, high-fructose corn syrup and other highly refined carbohydrates has been associated with a higher incidence of diabetes, cardiovascular disease, and even breast cancer. And eating refined carbs can, over time, result in almost uncontrollable sugar cravings. With the popularity of low-carb diets, many people are afraid to eat any carbohydrates, but it is important to distinguish between the health-robbing effects of simple sugars and other carbs, and the health-giving properties of complex carbohydrates. Complex carbohydrates are high-fiber foods, which improve your digestion. Examples: simple and complex carbohydrates. Some examples of healthy foods containing complex carbohydrates:. Some examples of foods containing simple carbohydrates:. Corn syrup. Bread made w...
*  Eviscerate WITHOUT a low CHO diet? -
Eviscerate WITHOUT a low CHO diet. News. Supplement News. Nutrition News. Weight Loss News. Training News. Men's Health News. Contest News. Research News. Forum. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. Supplement Forum. Nutrition Forum. Weight Loss Forum. Training Forum. Album Gallery. Forum. Supplement Forum. Eviscerate WITHOUT a low CHO diet. Eviscerate WITHOUT a low CHO diet. 03-16-2010, 09:41 PM. Eviscerate WITHOUT a low CHO diet. I know that cho intake just about fully negates the desired effect of yohimboine HCL and as I can no longer realy be super functioning on lower cho/keto type diets I'm wondering what else in the Eviscerate line up gets screwed over by cho intake. FWIW,my sources of cho are fairly decent;like 2 slices of toast in the AM or 200kcals worth of oatmeal along with a low cho pro shake.Though the oatmeal I use has another 10 or so grams of cho due to added sugar.I'm between 100-200 grams of cho per day but still in a signifigant kcal deficit 500-1000. 03-16...
*  Insulin index
The index is similar to the Glycemic Index and Glycemic Load, but rather than relying on blood glucose levels, the Insulin Index is based upon blood insulin levels. Insulin index represents a comparison food portions with equal overall caloric content 250 kcal or 1000 kJ, while GI and GL represents a comparison of portions with equal digestible carbohydrate content typically 50 g. This measure can be more useful than either the Glycemic Index or the Glycemic Load because certain foods e.g., lean meats and proteins cause an insulin response despite there being no carbohydrate s present, and some foods cause a disproportionate insulin response relative to their carbohydrate load. 1 but high-protein foods and bakery products that are rich in fat and refined carbohydrates "elicit insulin responses that were disproportionately higher than their glycemic responses." They also conclude that insulin indices may be useful for dietary management and avoidance of non-insulin-dependent diabetes mellitus and hyperlipidemi...
*  Carbohydrate loading
'Carbohydrate loading', commonly referred to as 'carb-loading' or 'carbo-loading', is a strategy used by endurance athletes, such as marathon runners, to maximize the storage of glycogen or energy in the muscles and liver. 1 Carbohydrate loading is generally recommended for endurance events lasting longer than 90 minutes. 2 Many endurance athletes prefer foods with low glycemic indices for carbo-loading due to their minimal effect on serum glucose levels. Without depletion Short workout Transient hypoglycemia Diet composition References Further reading. 4 Most athletes now follow this modified regimen and it is recommended by many coaches. Some athletes still follow the original carbo-loading regimen. 5 Short workout. On the day before the race, the athlete performs a very short, extremely high-intensity workout such as a few minutes of sprinting then consumes of carbohydrate per kilogram of lean mass over the next 24 hours. The regimen resulted in a 90% increase in glycogen storage when compared to before th...
*  Carbohydrates: To Use or Abuse? | Deepak Chopra
Deepak Chopra. Huffpost Healthy Living. Follow Newsletters. Get Healthy LivingNewsletters Email address. Huffington Post Search. iOS app. Android app. Women. Go to Women More in Women. Women's Health. Style. Weddings. Parents. Healthy Living. Taste. Go to Taste More in Taste. Healthy Eating. Healthy Living. Travel. Good News. Go to Good News You Might Also Like. GPS for the Soul. Healthy Living. Parents. Go to Parents More in Parents. Taste. Style. Go to Style More in Style. There are three main categories of carbohydrates : Simple sugars simple carbohydrates, such as those responsible for the sweetness in fruit fructose and table sugar sucrose. Carbs have long been neatly grouped into two categories that also make diet choice more clear cut: simple carbohydrates and complex carbohydrates. You've heard many times that we should be eating complex carbohydrates and shunning simple carbohydrates. It would be convenient if one group represents "good" carbs and the other "bad" carbs. Simple carbohydrates are so na...
*  Preservation of the gut by preoperative carbohydrate loading improves postoperative food intake.
... Advanced Search. Document Detail. Preservation of the gut by preoperative carbohydrate loading improves postoperative food intake. MedLine Citation:. BACKGROUND AIMS: A carbohydrate CHO drink given preoperatively changes the fasted state into a fed state. An intestinal ischaemia reperfusion IR animal model was used to investigate whether preoperative CHO loading increases spontaneous postoperative food intake, intestinal barrier function and the catabolic response. METHODS: Male Wistar rats n = 65 were subjected to 16 h fasting with ad libitum water and: A sham laparotomy Sham fasted, n = 24 ; B intestinal ischaemia IR fasted, n = 27 ; and C intestinal ischaemia with preoperatively access to a CHO drink IR CHO, n = 14. Spontaneous food intake, intestinal barrier function, insulin sensitivity, intestinal motility and plasma amino acids were measured after surgery. RESULTS: The IR CHO animals started eating significantly earlier and also ate significantly more than the IR fasted animals. Furthermore, preop...
*  .. Carbohydrates – Are They All Bad? .. Subscribe to Good For You .. .. .. Recent Comments ..
Amateur sports Beauty health Rockford. Uncategorized Carbohydrates – Are They All Bad. Carbohydrates – Are They All Bad. Comments Off on Carbohydrates – Are They All Bad. That energy comes from protein, fat, and carbohydrates. Carbohydrates are broken down into glucose which the body uses as its primary and most efficient source of energy. Carbohydrates are the only energy source the brain, nerves, and developing red cells can use for energy. Protein and fat are used as sources of energy only when carbohydrates are depleted. Complex carbohydrates include potatoes, oats, corn, peas, whole wheat pasta, beans, and brown rice and are excellent sources of energy. They are also a good source of protein, vitamins, and minerals. Complex carbohydrates contain fiber which will slow down the release of glucose. Simple carbohydrates white flour, white sugar raise glucose level, giving the body a burst of energy that burns quickly, causing a sudden drop in glucose levels, making us feel tired and hungry. Simple carbohydra...
*  high-carbohydrate - definition and meaning
... Community. Word of the day. Random word. Log in or Sign up. high-carbohydrate love. Define. Relate. List. Discuss. Hear. Help Wordnik hunt for a million missing words by backing our Kickstarter. high-carbohydrate. Define. Relate. List. Discuss. Hear. un Love. Definitions. Sorry, no definitions found. Etymologies. Sorry, no etymologies found. While weight loss was similar for both diets approximately 4.0 kg, reductions in LDL-C concentration were greater for the low-carbohydrate compared with the high-carbohydrate diet. Sharma’s Obesity Notes Blog Archive “Eco Atkins” Beats High-Carb Ovo-Lacto Vegetarian. From the limited information that one can derive from such a short-term study, it seems that the low-carbohydrate plant-based diet Eco Atkins has some advantages with regard to lowering lipids compared to a high-carbohydrate, low-fat weight-loss diet. Sharma’s Obesity Notes Blog Archive “Eco Atkins” Beats High-Carb Ovo-Lacto Vegetarian. The causes include low levels of so-called good cholesterol and life...
*  ARS | Publication request: Effect of dietary fat/carbohydrate ratio on progression of alcoholic live
Publication request: Effect of dietary fat/carbohydrate ratio on progression of alcoholic liver injury and bone loss in rats fed via total enteral nutrition TEN ARS : Research. ARS Office of International Research Programs. Title: Effect of dietary fat/carbohydrate ratio on progression of alcoholic liver injury and bone loss in rats fed via total enteral nutrition TEN Authors. Effect of dietary fat/carbohydrate ratio on progression of alcoholic liver injury and bone loss in rats fed via total enteral nutrition TEN. Technical Abstract: Few studies have examined the effects of diet on the dynamics of injury progression or on alcohol-induced bone loss. Dietary fat content was either 5% high carbohydrate, HC or 45% high fat, with or without ethanol EtOH substitution for carbohydrate calories to a final level of 13 g/kg/d. HC rats gained more weight and had larger fat pads than HF rats with or without EtOH, but blood EtOH values did not differ. Liver fat content increased more rapidly in EtOH/HC rats than EtOH/HF ...
*  ARS | Publication request: Effect of dietary fat/carbohydrate ratio on progression of alcoholic live
ARS. Publication request: Effect of dietary fat/carbohydrate ratio on progression of alcoholic liver injury and bone loss in rats fed via total enteral nutrition TEN ARS : Research. ARS Home. About ARS. International Programs. ARS National Programs. ARS Office of International Research Programs. Title: Effect of dietary fat/carbohydrate ratio on progression of alcoholic liver injury and bone loss in rats fed via total enteral nutrition TEN Authors. Submitted to: Toxicologist Publication Type: Abstract Only Publication Acceptance Date: November 1, 2011 Publication Date: March 15, 2012 Repository URL: Citation: Ronis, M.J., Mercer, K., Suva, L., Badeaux, J., Ferguson, M., Hogue, W., Sharma, N., Badger, T.M. Effect of dietary fat/carbohydrate ratio on progression of alcoholic liver injury and bone loss in rats fed via total enteral nutrition TEN. Technical Abstract: Few studies have examined the effects of diet on the dynamics of injury progression or on alcoho...
*  .. The flat stomach diet .. The big three .. Carbohydrates .. Protein .. Fat .. Other foods to avoi
The flat stomach diet Diet. The flat stomach diet is not a fad diet promising miracle weight loss. Fad diets are generally deficient in essential nutrients. They may deliver weight loss but this is often at the expense of your health. Further more they are unsustainable and when these diets are stopped, the weight comes piling back on. Fad diets are to be avoided. Instead you should eat according to sound nutritional principles which encourage the growth of lean muscle and discourage the storage of excess calories as fat. This key in understanding how to get flat stomach. The big three. The food you eat can be broken down in to three major macronutrient groups, ‘the big three’:. Carbohydrates Proteins Fats You need to learn about each one to understand how to plan your diet. Carbohydrates. Carbohydrates are the body’s main source of fuel for physical activity. Foods high in carbohydrates are bread, pasta, cereals and potatoes. Carbohydrates can be divided up into two categories:. Simple Carbohydrates Comple...
*  The Value Of Complex Carbs In Your Diet : Lakisha Toussaint & Beyond The Uniform Client Care
To get fit and turn into healthy, dieting and exercise go hand in hand. Although some diets advise the lowering of fats and carbohydrates, others recommend only the reduction of fats. Even though some diet programs recommend lower carbohydrate intake, now you ask, raised whether it will have any effect on weight reduction and the unsafe effects of weight. When the carbohydrate intake is reduced, there's no question that many people might see some initial reduction in weight loss, however, this just isn't sustained in the long run. Using a low carbohydrate diet will gradually result in a boost in lethargy and definately will result in a gradual increase in weight following your initial weight reduction. Often the initial weight reduction is really just the reduction in fluids from the cells, or water weight. This loss in fluids is not always healthy. What are the different forms of Carbohydrates and which of those forms ought to be consumed for promoting health insurance and improving weight-loss. There are tw...
*  - NEL
Intakes of fruits, vegetables and carbohydrate and the risk of CVD. Statistical Analysis Three groups were defined based on the percentage of energy derived from carbohydrate low, less than 40%; moderate, less than 40% to 55%; and high, less than 55% Cox proportional hazards regression analysis was used to assess whether a high intake of total or specific fruits and vegetables was associated with reduced risk of ischemic CVD among the three carbohydrate intake groups Analyses was performed separately for each cohort, and the results were also pooled to obtain overall estimates For the categorical analyses, the lowest quintile of intake formed the reference category The relative risk for the continuous measures was calculated and adjusted for standard CVD risk factors For each two-year follow-up period in which events were reported, the intake for each composite item was computed as a cumulative average of intake from all available food-frequency questionnaires FFQ up to the start of the follow-up period. No s...
*  Here is a list of low carbohydrate foods
HEALTH and : BACK To Diet FAQ's || Fitness FAQ's || Advice || Forums Here is a list of low carbohydrate foods In Reply to: low carb foods posted by vickie on March 07 at 10:30:30: This list is from the U.S. Department of Agriculture and has about 1000 low carbohydrate foods. Also, the amount of calories, protein, cholesterol and sodium are included for you to monitor your diet better. I am just starting too. Enjoy SUPERFOOD Protein Shakes are low-carb, low-sugar and very low fat. This is the Highest Quality Protein for Meal Replacement or to use for adding lean body weight. Only on H&F: Kangoo Jumps U.S. Department of Agriculture Description of food Weight Food Energy CarbohydrateProtein Fat CholesterolSodium (Grams)(Kilocalorie) (Grams) (Grams) (Grams)(Milligrams)(Milligram) BROWN AND SERVE SAUSAGE,BRWND 1 LINK 13 50 0 2 5 9 105 PORK, LUNCHEON MEAT,CHOPPD HAM2 SLICES 42 95 0 7 7 21 576 SUNFLOWER OIL 1 TBSP 14 125 0 0 14 0 0 PORK, CURED, HAM, ROSTED,LN+FT3 OZ 85 205 0 18 14 53 100...
*  Carbohydrates
Diet and nutrition. StayQuit - 90-day stop smoking programme. Weight loss programme. Diet and nutrition. Diet and nutrition Health centre. Diet and nutrition facts Healthy menu choices when eating out. Healthy eating 12 things you never knew could make you fat. Weight loss tips. Weight problems. Weight problems. Complex carbohydrates, as natural starches, are found in wholegrain cereals and brown rice. This is because they can be converted more readily into glucose, the form of sugar that's transported and used by the body, than proteins or fats can. It is better to balance your intake of carbohydrates with protein, a little fat and fibre. Complex carbohydrates as refined starches are found in: biscuits, pastries and cakes pizzas sugary processed breakfast cereals white bread white flour white pasta white rice. The difference between complex and simple carbohydrates All carbohydrates form glucose when digested. Complex carbohydrates provide a slower and more sustained release of energy than simple carbohydrat...
*  High Protein & Carbohydrate Foods | Get Fit - Jillian Michaels
High Protein Carbohydrate Foods. Get Fit - Jillian Michaels. Skip to main content. Jillian Michaels. The Regimen. The Routine. Sample Fitness Plan. The Fuel. Sample Meal Plan. The Tools. The App. Why it Works. The Results. 25-50 Lbs. Lost. 50-75 Lbs. Lost. 75-100 Lbs. Lost. 100-125 Lbs. Lost. 125+ Lbs. Lost. The Community. The Challenges. The Moderators. The Message Boards. Get Fit. Live Well. The Store. About Jillian. Jillian's Bio. Press. Books DVDs. Partners. Downloads. Business Inquiries. Register Now. Advertisement. Get Fit. Menu. Home. Diet Nutrition. Fitness Exercise. . High Protein Carbohydrate Foods. by Andrea Cespedes. About Andrea Cespedes. Andrea Cespedes is a professionally trained chef who has focused studies in nutrition. With more than 20 years of experience in the fitness industry, she coaches cycling and running and teaches Pilates and yoga. She is an American Council on Exercise-certified personal trainer, RYT-200 and has degrees from Princeton and Columbia University. X. Related Articles. ...
*  Karin R Sargrad
... add/edit. You are here: Scientific Experts USA. Drexel University Sargrad Karin R Sargrad. Research Topics indirect calorimetry glucose clamp technique reducing diet dietary carbohydrates electric impedance dietary proteins glycosylated hemoglobin a anthropometry area under curve energy metabolism type 2 diabetes mellitus blood glucose insulin body weight obesity blood pressure analysis of variance. Karin R Sargrad Summary Affiliation: Drexel University Country: USA. Publications Effect of high protein vs high carbohydrate intake on insulin sensitivity, body weight, hemoglobin A1c, and blood pressure in patients with type 2 diabetes mellitus Karin R Sargrad Nutrition Center, Department of Bioscience and Biotechnology, Drexel University, Philadelphia, PA 19104, USA J Am Diet Assoc 105:573-80. 2005. Collaborators Guenther Boden. Detail Information Publications 1 Effect of high protein vs high carbohydrate intake on insulin sensitivity, body weight, hemoglobin A1c, and blood pressure in patients with type 2...
* (7458064) New study finds that countries that use a lot of HFCS have more type 2 diabetic 7458064 New study finds that countries that use a lot of HFCS have more type 2 diabetics than countries that don't use as much HFCS. Fark. my Fark. New study finds that countries that use a lot of HFCS have more type 2 diabetics than countries that don't use as much HFCS 4 votes:. ZipSplat : Keep f*ckin' that HFCS chicken. Eating multiple times over the amount of simple carbohydrates that you should is going to result in diabetes. 4 votes:. 3 votes:. 3 votes:. The study reports that countries that use HFCS in their food supply had a 20 percent higher prevalence of diabetes than countries that did not use HFCS. So why would sugars be any different. 3 votes:. People somehow think that high glycemic index leads to high blood sugar leads to insulin leads to fat leads to diabetes. Eating multiple times over the amount of simple carbohydrates that you should is going to result in diabetes. Eating multiple times over the amount of simple carbohydrates that you should is going to resu...
*  High-Carbohydrate Diet Important For Young Athletes | MomsTeam
High-Carbohydrate Diet Important For Young Athletes. MomsTeam. My Account Sign In Sign Up. Connect with us:. Health Safety. Nutrition. Successful Parenting. Sports. Team Moms/Coaches. Team of Experts. Videos Blogs. Home. Nutrition Channel High-Carbohydrate Diet Important For Young Athletes 26848 reads Flag as offensive Printer-friendly version. High-Carbohydrate Diet Important For Young Athletes. Daily consumption of whole grain foods, vegetables and fruits is essential. By Suzanne Nelson, Sc.D., RD. carbohydrates diet FDA food guidance system glycogen MyPlate Nutrition Nutritional Needs Guidelines Sports Nutrition Basics youth athletes 8 to 10 11 to 13 14 to 18. When you or your child athlete thinks of food, you should think about carbohydrates, with the primary food sources being the whole-grain products, vegetables, and fruits that make up three quarters of the FDA's new MyPlate food guidance system. Studies have shown that adequate dietary carbohydrate must be consumed on a daily basis, especially after e...

Sucrose gap: The sucrose gap technique is used to create a conduction block in nerve or muscle fibers. A high concentration of sucrose is applied to the extracellular space to increase resistance between two groups of cells, which prevents the correct opening and closing of sodium and potassium channels.Carbohydrate loading: Carbohydrate loading, commonly referred to as carb-loading or carbo-loading, is a strategy used by endurance athletes, such as marathon runners, to maximize the storage of glycogen (or energy) in the muscles and liver.http://www.Sucrase: Sucrase is the name given to a number of enzymes located in on the brush border of the small intestine that catalyze the hydrolysis of sucrose to fructose and glucose. The enzyme invertase, which occurs more commonly in plants, also hydrolyzes sucrose but by a different mechanism.Starch gelatinization: Starch gelatinization is a process of breaking down the intermolecular bonds of starch molecules in the presence of water and heat, allowing the hydrogen bonding sites (the hydroxyl hydrogen and oxygen) to engage more water. This irreversibly dissolves the starch granule in water.JejunumAnimal fatProtein toxicity: Protein toxicity with proteinuria can result in those with preexisting kidney disease, or those who have lost kidney function due to age.Mayo Clinic Diet: The Mayo Clinic Diet is a diet created by Mayo Clinic. Prior to this, use of that term was generally connected to fad diets which had no association with Mayo Clinic.Complete Wheat Bran Flakes: Kellogg's Complete Wheat Bran Flakes is a breakfast cereal containing 100% of the United States' Recommended Dietary Allowance of eleven vitamins and minerals, including vitamins B1, B3, B5, B6, B12, C, E, and Iron, Riboflavin, Folic Acid, and Zinc. One 3/4 cup serving contains 3 grams of protein, 5 grams of dietary fiber and 90 calories, 5 of which come from fat.Dietary Supplements (database): The PubMed Dietary Supplement Subset (PMDSS) is a joint project between the National Institutes of Health (NIH) National Library of Medicine (NLM) and the NIH Office of Dietary Supplements (ODS). PMDSS is designed to help people search for academic journal articles related to dietary supplement literature.Calcium deficiency (plant disorder): Calcium (Ca) deficiency is a plant disorder that can be caused by insufficient calcium in the growing medium, but is more frequently a product of low transpiration of the whole plant or more commonly the affected tissue. Plants are susceptible to such localized calcium deficiencies in low or nontranspiring tissues because calcium is not transported in the phloem.List of countries by food energy intake: Food consumption refers to the amount of food available for human consumption as estimated by the FAO Food Balance Sheets. However the actual food consumption may be lower than the quantity shown as food availability depending on the magnitude of wastage and losses of food in the household, e.Salt and cardiovascular disease: Salt consumption has been intensely studied for its role in human physiology and impact on human health. In particular, excessive dietary salt consumption over an extended period of time has been associated with hypertension and cardiovascular disease, in addition to other adverse health effects.Dry matter: The dry matter (or otherwise known as dry weight) is a measurement of the mass of something when completely dried.Sweetness: Sweetness is one of the five basic tastes and is universally regarded as a pleasurable experience, except perhaps in excess. Foods rich in simple carbohydrates such as sugar are those most commonly associated with sweetness, although there are other natural and artificial compounds that are sweet at much lower concentrations, allowing their use as non-caloric sugar substitutes.Vegetable juiceBuoyant density ultracentrifugation: Buoyant density centrifugation uses the concept of buoyancy to separate molecules in solution. Usually a caesium chloride (CsCl) solution is used, but in the general case it's usually approximately the same density as the molecules that are to be centrifuged.PRX-07034: PRX-07034 is a selective 5-HT6 receptor antagonist. It has cognition and memory-enhancing properties and potently decreases food intake and body weight in rodents.Fructose malabsorptionFruit snack: A fruit snack is a processed food eaten as a snack in the United States. Fruit snacks are very similar to gummi candies.Liver sinusoid: A liver sinusoid is a type of sinusoidal blood vessel (with fenestrated, discontinuous endothelium) that serves as a location for the oxygen-rich blood from the hepatic artery and the nutrient-rich blood from the portal vein.SIU SOM Histology GITaste: Taste, gustatory perception, or gustationAdjectival form: [is the sensory impression of food] or other substances on the tongue and is one of the [[sense|five traditional senses.Heptadecanoic acidInvertase: Invertase is an enzyme that catalyzes the hydrolysis (breakdown) of sucrose (table sugar). Alternate names for invertase include , saccharase, glucosucrase, beta-h-fructosidase, beta-fructosidase, invertin, sucrase, maxinvert L 1000, fructosylinvertase, alkaline invertase, acid invertase, and the systematic name: beta-fructofuranosidase.Abscisate beta-glucosyltransferase: Abscisate beta-glucosyltransferase (, ABA-glucosyltransferase, ABA-GTase, AOG) is an enzyme with system name UDP-D-glucose:abscisate beta-D-glucosyltransferase. This enzyme catalyses the following chemical reactionHealthy eating pyramid: The healthy eating pyramid is a nutrition guide developed by the Harvard School of Public Health, suggesting quantities of each food category that a human should eat each day. The healthy eating pyramid is intended to provide a superior eating guide than the widespread food guide pyramid created by the USDA.CholesterolGeneral Mills monster-themed breakfast cereals

(1/586) Apparent ileal and total-tract nutrient digestion by pigs as affected by dietary nondigestible oligosaccharides.

The effects of two types of nondigestible oligosaccharides (NDO), fructooligosaccharides (FOS), and transgalactooligosaccharides (TOS) were studied on growing and weanling pigs' nutrient digestion. Dietary NDO were included at the expense of purified cellulose. Twenty-five 57-d-old growing pigs, averaging 15.9+/-.6 kg on d 0 of the experiment, were fed a corn-based control diet or the control with 6.8 or 13.5 g of FOS/kg or 4.0 or 8.0 g of TOS/kg (five pigs per diet). Feces were collected on d 28 to 32, and small-intestinal digesta were collected (slaughter technique) on d 42 to 47 of the experiment. Feeds, feces, and digesta were analyzed for DM, inorganic matter, CP, ether extract, and crude fiber. Dietary NDO did not significantly affect apparent fecal and small intestinal digestion of nutrients in growing pigs. After being fed a NDO-free diet through d 10 after weaning, 38-d-old weanling pigs (n = 20), averaging 10.4+/-.8 kg on d 0 of the experiment, were fed a control diet (based on cornstarch, casein, and oat husk meal) or the control with 10 or 40 g of FOS or TOS/kg (four pigs per diet). Feces and urine were collected on d 13 to 17, and ileal digesta were collected via a postvalve T-cecum cannula on d 33 to 37 of the experiment. Feeds, feces, and digesta were analyzed for DM, inorganic matter, CP, ether extract, starch, NDF, ADF, ADL, Ca, P, Mg, Fe, Cu, and Zn. Nonstarch neutral-detergent soluble carbohydrates (NNSC) completed the mass balance for the carbohydrates. Urine was analyzed for N and minerals. The apparent fecal digestion of NNSC increased in the NDO-supplemented diets. The TOS-fed pigs tended (P<.10) to have a higher apparent fecal digestion of CP than the FOS-fed and control pigs but excreted more N via the urine (P<.01). Nitrogen and mineral balances were not affected. The FOS was nearly completely degraded prececally. Mean fiber digestion was lower at the fecal compared with the ileal level, as was the extent of NDO effects. This indicates that fiber digestion requires more than 2 wk to adapt to dietary NDO. Apparent ileal digestion of hemicellulose increased for the NDO-supplemented diets (P<.05), but that of NNSC decreased (P<.001). Thus, under the well-controlled conditions of this experiment, dietary NDO hardly affected nutrient digestion in well-kept growing and weanling pigs. However, digestion of dietary nonstarch carbohydrates may be affected.  (+info)

(2/586) Insulin resistance of muscle glucose transport in male and female rats fed a high-sucrose diet.

It has been reported that, unlike high-fat diets, high-sucrose diets cause insulin resistance in the absence of an increase in visceral fat and that the insulin resistance develops only in male rats. This study was done to 1) determine if isolated muscles of rats fed a high-sucrose diet are resistant to stimulation of glucose transport when studied in vitro and 2) obtain information regarding how the effects of high-sucrose and high-fat diets on muscle insulin resistance differ. We found that, compared with rat chow, semipurified high-sucrose and high-starch diets both caused increased visceral fat accumulation and insulin resistance of skeletal muscle glucose transport. Insulin responsiveness of 2-deoxyglucose (2-DG) transport measured in epitrochlearis and soleus muscles in vitro was decreased approximately 40% (P < 0.01) in both male and female rats fed a high-sucrose compared with a chow diet. The high-sucrose diet also caused resistance of muscle glucose transport to stimulation by contractions. There was a highly significant negative correlation between stimulated muscle 2-DG transport and visceral fat mass. In view of these results, the differences in insulin action in vivo observed by others in rats fed isocaloric high-sucrose and high-starch diets must be due to additional, specific effects of sucrose that do not carry over in muscles studied in vitro. We conclude that, compared with rat chow, semipurified high-sucrose and high-cornstarch diets, like high-fat diets, cause increased visceral fat accumulation and severe resistance of skeletal muscle glucose transport to stimulation by insulin and contractions.  (+info)

(3/586) Rapidly available glucose in foods: an in vitro measurement that reflects the glycemic response.

BACKGROUND: A chemically based classification of dietary carbohydrates that takes into account the likely site, rate, and extent of digestion is presented. The classification divides dietary carbohydrates into sugars, starch fractions, and nonstarch polysaccharides, and groups them into rapidly available glucose (RAG) and slowly available glucose (SAG) as to the amounts of glucose (from sugar and starch, including maltodextrins) likely to be available for rapid and slow absorption, respectively, in the human small intestine. OBJECTIVE: We hypothesize that RAG is an important food-related determinant of the glycemic response. DESIGN: The measurement of RAG, SAG, and starch fractions by an in vitro technique is described, based on the measurement by HPLC of the glucose released from a test food during timed incubation with digestive enzymes under standardized conditions. Eight healthy adult subjects consumed 8 separate test meals ranging in RAG content from 11 to 49 g. RESULTS: The correlation between glycemic response and RAG was highly significant (P < 0.0001) and a given percentage increase in RAG was associated with the same percentage increase in glycemic response. After subject variation was accounted for, RAG explained 70% of the remaining variance in glycemic response. CONCLUSIONS: We show the significance of in vitro measurements of RAG in relation to glycemic response in human studies. The simple in vitro measurement of RAG and SAG is of physiologic relevance and could serve as a tool for investigating the importance of the amount, type, and form of dietary carbohydrates for health.  (+info)

(4/586) Net postprandial utilization of [15N]-labeled milk protein nitrogen is influenced by diet composition in humans.

The aim of this study was to follow the fate of dietary nitrogen to assess the postprandial utilization of purified milk protein and to determine the acute influence of energy nutrients. For this purpose, a [15N]-labeling dietary protein approach was used. Twenty-five subjects swallowed an ileal tube and ingested [15 N]-milk protein alone or supplemented with either milk fat or sucrose. The absorption and postprandial deamination of dietary protein was monitored for 8 h. Sucrose delayed the absorption of protein longer than fat, but the ileal digestibility did not differ among groups (94.5-94.8%). Sucrose, but not fat, significantly reduced the postprandial transfer of [15N]-milk nitrogen to urea. Consequently, the net postprandial protein utilization (NPPU) of milk protein calculated 8 h after meal ingestion was 80% when ingested either alone or supplemented with fat and was significantly greater with sucrose (NPPU = 85%). This study shows that energy nutrients do not affect the nitrogen absorption but modify the metabolic utilization of dietary protein in the phase of nitrogen gain. Our method provides information concerning the deamination kinetics of dietary amino acids and further allows the detection of differences of dietary protein utilization in acute conditions. The diet composition should be carefully considered, and protein quality must be determined under optimal conditions of utilization.  (+info)

(5/586) Sucrase-isomaltase and hexose transporter gene expressions are coordinately enhanced by dietary fructose in rat jejunum.

We previously demonstrated that the levels of mRNAs of both sucrase-isomaltase (SI) and sodium/D-glucose transporter (SGLT1) are modulated by dietary sucrose in the rat jejunum. In the present study, we investigated whether the transcription of the gene coding SI is regulated by certain types of monosaccharides. Force-feeding a fructose and sucrose diet, (40% energy as fructose or sucrose) gave rise to parallel increases in the transcripts of SI and intestinal hexose transporters (SGLT1, GLUT5, and GLUT2) within 12 h. Force-feeding a glycerol-containing diet also caused an enhancement of SI, SGLT1, and GLUT2 mRNA levels. However, feeding the diet containing glucose or alpha-methylglucoside generally did not increase the transcript levels of SI or the intestinal hexose transporters. Nuclear run-on assays revealed that fructose as well as sucrose increased the transcription of both SI and GLUT5 genes and that the transcription rates of these genes were unaffected by glucose. These results suggest that fructose (or a metabolite) is capable of increasing the mRNA levels of SI and hexose transporters in the small intestine and that transcriptional regulation might play a pivotal role in the carbohydrate-induced coordinate enhancement of SI and fructose transporter gene expression  (+info)

(6/586) Western-type diets induce insulin resistance and hyperinsulinemia in LDL receptor-deficient mice but do not increase aortic atherosclerosis compared with normoinsulinemic mice in which similar plasma cholesterol levels are achieved by a fructose-rich diet.

The role of insulin resistance (IR) in atherogenesis is poorly understood, in part because of a lack of appropriate animal models. We assumed that fructose-fed LDL receptor-deficient (LDLR-/-) mice might be a model of IR and atherosclerosis because (1) fructose feeding induces hyperinsulinemia and IR in rats; (2) a preliminary experiment showed that fructose feeding markedly increases plasma cholesterol levels in LDLR-/- mice; and (3) hypercholesterolemic LDLR-/- mice develop extensive atherosclerosis. To test whether IR could be induced in LDLR-/- mice, 3 groups of male mice were fed a fructose-rich diet (60% of total calories; n=16), a fat-enriched (Western) diet intended to yield the same plasma cholesterol levels (n=18), or regular chow (n=7) for approximately 5.5 months. The average cholesterol levels of both hypercholesterolemic groups were similar (849+/-268 versus 964+/-234 mg/dL) and much higher than in the chow-fed group (249+/-21 mg/dL). Final body weights in the Western diet group were higher (39+/-6.2 g) than in the fructose- (27.8+/-2.7 g) or chow-fed (26.7+/-3.8 g) groups. Contrary to expectation, IR was induced in mice fed the Western diet, but not in fructose-fed mice. The Western diet group had higher average glucose levels (187+/-16 versus 159+/-12 mg/dL) and 4.5-fold higher plasma insulin levels. Surprisingly, the non-insulin-resistant, fructose-fed mice had significantly more atherosclerosis than the insulin-resistant mice fed Western diet (11.8+/-2.9% versus 7.8+/-2. 5% of aortic surface; P<0.01). These results suggest that (1) fructose-enriched diets do not induce IR in LDLR-/- mice; (2) the Western diets commonly used in LDLR-/- mice may not only induce atherosclerosis, but also IR, potentially complicating the interpretation of results; and (3) IR and hyperinsulinemia do not enhance atherosclerosis in LDLR-/- mice, at least under conditions of very high plasma cholesterol levels. The fact that various levels of hypercholesterolemia can be induced in LDLR-/- mice by fat-enriched diets and that such diets induce IR and hyperinsulinemia suggest that LDLR-/- mice may be used as models to elucidate the effect of IR on atherosclerosis, eg, by feeding them Western diets with or without insulin-sensitizing agents.  (+info)

(7/586) Effect of diet on fat cell size and hormone-sensitive lipase activity.

This study was designed to examine the relationship between diet-induced insulin resistance/hyperinsulinemia, fat cell hypertrophy, and hormone-sensitive lipase (HSL) to elucidate whether an attenuated HSL activity leads to obesity. Female Fischer 344 rats were fed either a low-fat, complex-carbohydrate diet or a high-fat, refined-sugar (HFS) diet for 2 wk, 2 mo, or 6 mo. Adipose tissue morphology and HSL activity as well as plasma free fatty acid and glycerol levels were determined at these times. No differences between groups were seen after 2 wk except the previously reported hyperinsulinemia in the HFS animals. At both 2 and 6 mo, the HFS animals demonstrated adipocyte hypertrophy. Basal and stimulated HSL activities and plasma glycerol were significantly elevated in the HFS group. There was a positive correlation between adipocyte size and HSL activity for both basal and stimulated states. These results demonstrate that an attenuated HSL activity is not observed with the onset of insulin resistance/hyperinsulinemia and therefore does not play a role in the development of obesity.  (+info)

(8/586) Association between preference for sweets and excessive alcohol intake: a review of animal and human studies.

This report reviews a series of studies demonstrating a relationship between the consumption of sweets and alcohol consumption. There is consistent evidence linking the consumption of sweets to alcohol intake in both animals and humans, and there are indications that this relationship may be at least partially genetic in nature. Alcohol-preferring rats have a tendency to consume sucrose and saccharin solutions far beyond the limits of their normal fluid intake and this has been proposed to be a model of the clinical phenomenon known as loss of control. Furthermore, rats and mice, genetically bred to prefer alcohol, tend to choose more concentrated sweet solutions, compared to animals which do not prefer alcohol. Similar tendencies to prefer ultra-sweet solutions have been noted in studies of alcoholic subjects, with most alcoholics preferring sweeter sucrose solutions than do controls. Evidence also exists that those alcoholics who prefer sweeter solutions may represent a familial form of alcoholism. Finally, consumption of sweets and/or sweet solutions may significantly suppress alcohol intake in both animals and in alcoholics. Carbohydrate structure and sweet taste may contribute to this effect through different physiological mechanisms involving serotonergic, opioid, and dopaminergic functions. The possibility that there is concordance between sweet liking and alcohol consumption and/or alcoholism has theoretical, biological, and diagnostic/practical implications.  (+info)

How much energy does it take to convert dietary carbohydrate into body fat?

1. Much less than it takes to convert dietary fat into body fat.

 2. The same amount as it takes to convert dietary fat into body fat.

 3. Much more than it takes to convert dietary fat into body fat.

 4. A little more than it takes to convert dietary fat into body fat.

 5. A little less than it takes to convert dietary fat into body fat.

much less than it takes to convert dietary fat into bodyfat

Is it safe and recomended to take several dietary supplements a day?

Is it safe and/or recomended to take several dietary supplements a day (like one Iron, one vitamin C, a B complex and a Calcium +D +Zinc?) Or rather take a vitamin complex like "One a Day or Centrum?

Dietary supplements are completely safe. But it is better to take a single supplement per day.different types of supplements are available at

What is a dietary position at a nursing home?

I'm applying for a job at a nursing home and I have a choice between dietary and housekeeping but I don't know what that department does. Which one would you think would be better or easier?

I work in a convalescent hospital as a CNA...dietary position just means you work in the kitchen, especially if it's categorized along with housekeeping. Let me tell you now...our kitchen staff sweat their butts off and work hard...if they mess up a meal plan and put sugar on a diabetic's tray or give whole food to a patient who's supposed to have softened food....big problems! the housekeeping staff seem like they're always working on cleaning something (floors,walls,toilets,beds). Housekeeping includes laundry...old people don't always make it to the restroom in time.

How does dietary fat enhance your energy?

I know about different types, but how does dietary fat enhance your energy more so than carbohydrates? Which is more optimal for the body?

If you were to eat a meal consisting of both fats and carbohydrates, the body would prefer to use the carbs as energy first and foremost (primarily), as they are easily turned into glucose and used by insulin to store fat into fat cells (not really a bad thing, despite what you hear from a lot of wannabe health nuts) and synthesize glucose into glycogen in the body's muscle fibers.

Dietary fat, however, can be a different use of energy by the body. Fats naturally regulate your body's hormones, work out the kinks in your immune system and keep your body 'going'. Fats are a necessity to live, and so is protein, but carbs are not (although carbs are a great source of energy, and I advocate eating them, as they're in foods that are universally DELICIOUS).

What percentage of dietary energy should total fat intake be?

Like, what percentage of your dietary energy should be from you total fat intake.
Please, helpful answers only :)

The general rule is about 25% fat.

So let's say you eat 2,000 calories a day. 25% of that is 500. So 500 of those calories should be coming from fat. Since a single gram of fat has 9 calories, you would divide 500 by 9 which is about 56. This number is the number of grams of fat you would want to have for your 2,000 calorie diet (if you are doing 25% fat intake).

Whats the difference between the food pyramid and the dietary guidelines?

Please help me out, what is the difference between the food pyramid and the dietary guidelines (FOR TEENS/Adolescence), can you please also apply some good website if you have any, help me out please :( :)

The food pyramid shows what you need to eat and what to eat more of and less of. Food pyramids differ from different countries as your body needs a certain diet for a certain climate. 
The dietary guidelines in the U.S might differ from other countries but they are about the same for every human.

You could check out for more information. They have information about a few food pyramids including the USDA food pyramid.

what is the difference between sucrose and aspartame?

I want to cut out aspartame out of my diet but I've noticed that many foods  contain sucrose.  Is sucrose a  form of aspartame? Is it just as bad?

Sucrose (common name: table sugar, also called saccharose) is a disaccharide of glucose and fructose, with the molecular formula C12H22O11. Its systematic name is α-D-glucopyranosyl- (1↔2)-β-D-fructofuranoside (ending in "oside", because it's not a reducing sugar). It is best known for its role in human nutrition and is formed by plants but not by other organisms such as animals.

Aspartame (or APM) (pronounced /ˈæspɚteɪm/ or /əˈspɑrteɪm/) is the name for an artificial, non-saccharide sweetener, aspartyl-phenylalanine-1-methyl ester; that is, a methyl ester of the dipeptide of the amino acids aspartic acid and phenylalanine.

What dietary adjustments do you need to make regarding the nutrition of a pregnant woman?

Regarding the number of calories needed, nutrients, vitamins and minerals. are there certain dietary restrictions?   

(I need to know for a school project and i have no idea).

A pregnant woman only needs to consume 300 extra calories a day. Including plenty of fruits and vegetables will help her to stay healthy and provide proper nutrition for her baby. Additionally, she need to take a prenatal vitamin that includes folic acid. 

There usually isn't dietary restrictions unless she has a condition like Gestational Diabetes or another condition. 

Regular exercise is also helpful.

Good luck on your project.