Diabetes Mellitus, Type 2: A subclass of DIABETES MELLITUS that is not INSULIN-responsive or dependent (NIDDM). It is characterized initially by INSULIN RESISTANCE and HYPERINSULINEMIA; and eventually by GLUCOSE INTOLERANCE; HYPERGLYCEMIA; and overt diabetes. Type II diabetes mellitus is no longer considered a disease exclusively found in adults. Patients seldom develop KETOSIS but often exhibit OBESITY.Diabetes Mellitus: A heterogeneous group of disorders characterized by HYPERGLYCEMIA and GLUCOSE INTOLERANCE.Diabetes Mellitus, Type 1: A subtype of DIABETES MELLITUS that is characterized by INSULIN deficiency. It is manifested by the sudden onset of severe HYPERGLYCEMIA, rapid progression to DIABETIC KETOACIDOSIS, and DEATH unless treated with insulin. The disease may occur at any age, but is most common in childhood or adolescence.Diabetes Complications: Conditions or pathological processes associated with the disease of diabetes mellitus. Due to the impaired control of BLOOD GLUCOSE level in diabetic patients, pathological processes develop in numerous tissues and organs including the EYE, the KIDNEY, the BLOOD VESSELS, and the NERVE TISSUE.Diabetes Mellitus, Experimental: Diabetes mellitus induced experimentally by administration of various diabetogenic agents or by PANCREATECTOMY.Blood Glucose: Glucose in blood.Diabetes, Gestational: Diabetes mellitus induced by PREGNANCY but resolved at the end of pregnancy. It does not include previously diagnosed diabetics who become pregnant (PREGNANCY IN DIABETICS). Gestational diabetes usually develops in late pregnancy when insulin antagonistic hormones peaks leading to INSULIN RESISTANCE; GLUCOSE INTOLERANCE; and HYPERGLYCEMIA.Hypoglycemic Agents: Substances which lower blood glucose levels.Insulin: A 51-amino acid pancreatic hormone that plays a major role in the regulation of glucose metabolism, directly by suppressing endogenous glucose production (GLYCOGENOLYSIS; GLUCONEOGENESIS) and indirectly by suppressing GLUCAGON secretion and LIPOLYSIS. Native insulin is a globular protein comprised of a zinc-coordinated hexamer. Each insulin monomer containing two chains, A (21 residues) and B (30 residues), linked by two disulfide bonds. Insulin is used as a drug to control insulin-dependent diabetes mellitus (DIABETES MELLITUS, TYPE 1).Hemoglobin A, Glycosylated: Minor hemoglobin components of human erythrocytes designated A1a, A1b, and A1c. Hemoglobin A1c is most important since its sugar moiety is glucose covalently bound to the terminal amino acid of the beta chain. Since normal glycohemoglobin concentrations exclude marked blood glucose fluctuations over the preceding three to four weeks, the concentration of glycosylated hemoglobin A is a more reliable index of the blood sugar average over a long period of time.Risk Factors: An aspect of personal behavior or lifestyle, environmental exposure, or inborn or inherited characteristic, which, on the basis of epidemiologic evidence, is known to be associated with a health-related condition considered important to prevent.Hyperglycemia: Abnormally high BLOOD GLUCOSE level.Glucose Tolerance Test: A test to determine the ability of an individual to maintain HOMEOSTASIS of BLOOD GLUCOSE. It includes measuring blood glucose levels in a fasting state, and at prescribed intervals before and after oral glucose intake (75 or 100 g) or intravenous infusion (0.5 g/kg).Diabetic Angiopathies: VASCULAR DISEASES that are associated with DIABETES MELLITUS.Diabetic Nephropathies: KIDNEY injuries associated with diabetes mellitus and affecting KIDNEY GLOMERULUS; ARTERIOLES; KIDNEY TUBULES; and the interstitium. Clinical signs include persistent PROTEINURIA, from microalbuminuria progressing to ALBUMINURIA of greater than 300 mg/24 h, leading to reduced GLOMERULAR FILTRATION RATE and END-STAGE RENAL DISEASE.Diabetic Neuropathies: Peripheral, autonomic, and cranial nerve disorders that are associated with DIABETES MELLITUS. These conditions usually result from diabetic microvascular injury involving small blood vessels that supply nerves (VASA NERVORUM). Relatively common conditions which may be associated with diabetic neuropathy include third nerve palsy (see OCULOMOTOR NERVE DISEASES); MONONEUROPATHY; mononeuropathy multiplex; diabetic amyotrophy; a painful POLYNEUROPATHY; autonomic neuropathy; and thoracoabdominal neuropathy. (From Adams et al., Principles of Neurology, 6th ed, p1325)Insulin Resistance: Diminished effectiveness of INSULIN in lowering blood sugar levels: requiring the use of 200 units or more of insulin per day to prevent HYPERGLYCEMIA or KETOSIS.Diabetic Retinopathy: Disease of the RETINA as a complication of DIABETES MELLITUS. It is characterized by the progressive microvascular complications, such as ANEURYSM, interretinal EDEMA, and intraocular PATHOLOGIC NEOVASCULARIZATION.Prevalence: The total number of cases of a given disease in a specified population at a designated time. It is differentiated from INCIDENCE, which refers to the number of new cases in the population at a given time.Obesity: A status with BODY WEIGHT that is grossly above the acceptable or desirable weight, usually due to accumulation of excess FATS in the body. The standards may vary with age, sex, genetic or cultural background. In the BODY MASS INDEX, a BMI greater than 30.0 kg/m2 is considered obese, and a BMI greater than 40.0 kg/m2 is considered morbidly obese (MORBID OBESITY).Islets of Langerhans: Irregular microscopic structures consisting of cords of endocrine cells that are scattered throughout the PANCREAS among the exocrine acini. Each islet is surrounded by connective tissue fibers and penetrated by a network of capillaries. There are four major cell types. The most abundant beta cells (50-80%) secrete INSULIN. Alpha cells (5-20%) secrete GLUCAGON. PP cells (10-35%) secrete PANCREATIC POLYPEPTIDE. Delta cells (~5%) secrete SOMATOSTATIN.Pregnancy in Diabetics: The state of PREGNANCY in women with DIABETES MELLITUS. This does not include either symptomatic diabetes or GLUCOSE INTOLERANCE induced by pregnancy (DIABETES, GESTATIONAL) which resolves at the end of pregnancy.Streptozocin: An antibiotic that is produced by Stretomyces achromogenes. It is used as an antineoplastic agent and to induce diabetes in experimental animals.Diabetic Ketoacidosis: A life-threatening complication of diabetes mellitus, primarily of TYPE 1 DIABETES MELLITUS with severe INSULIN deficiency and extreme HYPERGLYCEMIA. It is characterized by KETOSIS; DEHYDRATION; and depressed consciousness leading to COMA.Body Mass Index: An indicator of body density as determined by the relationship of BODY WEIGHT to BODY HEIGHT. BMI=weight (kg)/height squared (m2). BMI correlates with body fat (ADIPOSE TISSUE). Their relationship varies with age and gender. For adults, BMI falls into these categories: below 18.5 (underweight); 18.5-24.9 (normal); 25.0-29.9 (overweight); 30.0 and above (obese). (National Center for Health Statistics, Centers for Disease Control and Prevention)Hypertension: Persistently high systemic arterial BLOOD PRESSURE. Based on multiple readings (BLOOD PRESSURE DETERMINATION), hypertension is currently defined as when SYSTOLIC PRESSURE is consistently greater than 140 mm Hg or when DIASTOLIC PRESSURE is consistently 90 mm Hg or more.Prediabetic State: The time period before the development of symptomatic diabetes. For example, certain risk factors can be observed in subjects who subsequently develop INSULIN RESISTANCE as in type 2 diabetes (DIABETES MELLITUS, TYPE 2).Case-Control Studies: Studies which start with the identification of persons with a disease of interest and a control (comparison, referent) group without the disease. The relationship of an attribute to the disease is examined by comparing diseased and non-diseased persons with regard to the frequency or levels of the attribute in each group.Glucose Intolerance: A pathological state in which BLOOD GLUCOSE level is less than approximately 140 mg/100 ml of PLASMA at fasting, and above approximately 200 mg/100 ml plasma at 30-, 60-, or 90-minute during a GLUCOSE TOLERANCE TEST. This condition is seen frequently in DIABETES MELLITUS, but also occurs with other diseases and MALNUTRITION.Prospective Studies: Observation of a population for a sufficient number of persons over a sufficient number of years to generate incidence or mortality rates subsequent to the selection of the study group.Hypoglycemia: A syndrome of abnormally low BLOOD GLUCOSE level. Clinical hypoglycemia has diverse etiologies. Severe hypoglycemia eventually lead to glucose deprivation of the CENTRAL NERVOUS SYSTEM resulting in HUNGER; SWEATING; PARESTHESIA; impaired mental function; SEIZURES; COMA; and even DEATH.Follow-Up Studies: Studies in which individuals or populations are followed to assess the outcome of exposures, procedures, or effects of a characteristic, e.g., occurrence of disease.Cardiovascular Diseases: Pathological conditions involving the CARDIOVASCULAR SYSTEM including the HEART; the BLOOD VESSELS; or the PERICARDIUM.Cohort Studies: Studies in which subsets of a defined population are identified. These groups may or may not be exposed to factors hypothesized to influence the probability of the occurrence of a particular disease or other outcome. Cohorts are defined populations which, as a whole, are followed in an attempt to determine distinguishing subgroup characteristics.Sulfonylurea CompoundsInsulin-Secreting Cells: A type of pancreatic cell representing about 50-80% of the islet cells. Beta cells secrete INSULIN.Diabetes Insipidus: A disease that is characterized by frequent urination, excretion of large amounts of dilute URINE, and excessive THIRST. Etiologies of diabetes insipidus include deficiency of antidiuretic hormone (also known as ADH or VASOPRESSIN) secreted by the NEUROHYPOPHYSIS, impaired KIDNEY response to ADH, and impaired hypothalamic regulation of thirst.Glucose: A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.Metformin: A biguanide hypoglycemic agent used in the treatment of non-insulin-dependent diabetes mellitus not responding to dietary modification. Metformin improves glycemic control by improving insulin sensitivity and decreasing intestinal absorption of glucose. (From Martindale, The Extra Pharmacopoeia, 30th ed, p289)Incidence: The number of new cases of a given disease during a given period in a specified population. It also is used for the rate at which new events occur in a defined population. It is differentiated from PREVALENCE, which refers to all cases, new or old, in the population at a given time.Blood Glucose Self-Monitoring: Self evaluation of whole blood glucose levels outside the clinical laboratory. A digital or battery-operated reflectance meter may be used. It has wide application in controlling unstable insulin-dependent diabetes.Time Factors: Elements of limited time intervals, contributing to particular results or situations.Retrospective Studies: Studies used to test etiologic hypotheses in which inferences about an exposure to putative causal factors are derived from data relating to characteristics of persons under study or to events or experiences in their past. The essential feature is that some of the persons under study have the disease or outcome of interest and their characteristics are compared with those of unaffected persons.C-Peptide: The middle segment of proinsulin that is between the N-terminal B-chain and the C-terminal A-chain. It is a pancreatic peptide of about 31 residues, depending on the species. Upon proteolytic cleavage of proinsulin, equimolar INSULIN and C-peptide are released. C-peptide immunoassay has been used to assess pancreatic beta cell function in diabetic patients with circulating insulin antibodies or exogenous insulin. Half-life of C-peptide is 30 min, almost 8 times that of insulin.Albuminuria: The presence of albumin in the urine, an indicator of KIDNEY DISEASES.Fasting: Abstaining from all food.Treatment Outcome: Evaluation undertaken to assess the results or consequences of management and procedures used in combating disease in order to determine the efficacy, effectiveness, safety, and practicability of these interventions in individual cases or series.Biological Markers: Measurable and quantifiable biological parameters (e.g., specific enzyme concentration, specific hormone concentration, specific gene phenotype distribution in a population, presence of biological substances) which serve as indices for health- and physiology-related assessments, such as disease risk, psychiatric disorders, environmental exposure and its effects, disease diagnosis, metabolic processes, substance abuse, pregnancy, cell line development, epidemiologic studies, etc.Glutamate Decarboxylase: A pyridoxal-phosphate protein that catalyzes the alpha-decarboxylation of L-glutamic acid to form gamma-aminobutyric acid and carbon dioxide. The enzyme is found in bacteria and in invertebrate and vertebrate nervous systems. It is the rate-limiting enzyme in determining GAMMA-AMINOBUTYRIC ACID levels in normal nervous tissues. The brain enzyme also acts on L-cysteate, L-cysteine sulfinate, and L-aspartate. EC 4.1.1.15.Cross-Sectional Studies: Studies in which the presence or absence of disease or other health-related variables are determined in each member of the study population or in a representative sample at one particular time. This contrasts with LONGITUDINAL STUDIES which are followed over a period of time.Risk Assessment: The qualitative or quantitative estimation of the likelihood of adverse effects that may result from exposure to specified health hazards or from the absence of beneficial influences. (Last, Dictionary of Epidemiology, 1988)Diabetic Diet: A diet prescribed in the treatment of diabetes mellitus, usually limited in the amount of sugar or readily available carbohydrate. (Dorland, 27th ed)Comorbidity: The presence of co-existing or additional diseases with reference to an initial diagnosis or with reference to the index condition that is the subject of study. Comorbidity may affect the ability of affected individuals to function and also their survival; it may be used as a prognostic indicator for length of hospital stay, cost factors, and outcome or survival.Age Factors: Age as a constituent element or influence contributing to the production of a result. It may be applicable to the cause or the effect of a circumstance. It is used with human or animal concepts but should be differentiated from AGING, a physiological process, and TIME FACTORS which refers only to the passage of time.Pregnancy: The status during which female mammals carry their developing young (EMBRYOS or FETUSES) in utero before birth, beginning from FERTILIZATION to BIRTH.Mice, Inbred NOD: A strain of non-obese diabetic mice developed in Japan that has been widely studied as a model for T-cell-dependent autoimmune insulin-dependent diabetes mellitus in which insulitis is a major histopathologic feature, and in which genetic susceptibility is strongly MHC-linked.Blood Pressure: PRESSURE of the BLOOD on the ARTERIES and other BLOOD VESSELS.Metabolic Syndrome X: A cluster of metabolic risk factors for CARDIOVASCULAR DISEASES and TYPE 2 DIABETES MELLITUS. The major components of metabolic syndrome X include excess ABDOMINAL FAT; atherogenic DYSLIPIDEMIA; HYPERTENSION; HYPERGLYCEMIA; INSULIN RESISTANCE; a proinflammatory state; and a prothrombotic (THROMBOSIS) state. (from AHA/NHLBI/ADA Conference Proceedings, Circulation 2004; 109:551-556)Multivariate Analysis: A set of techniques used when variation in several variables has to be studied simultaneously. In statistics, multivariate analysis is interpreted as any analytic method that allows simultaneous study of two or more dependent variables.Rats, Inbred BB: A strain of Rattus norvegicus which is a model for spontaneous insulin-dependent diabetes mellitus (DIABETES MELLITUS, INSULIN-DEPENDENT).AlloxanThiazolidinediones: THIAZOLES with two keto oxygens. Members are insulin-sensitizing agents which overcome INSULIN RESISTANCE by activation of the peroxisome proliferator activated receptor gamma (PPAR-gamma).United StatesSex Factors: Maleness or femaleness as a constituent element or influence contributing to the production of a result. It may be applicable to the cause or effect of a circumstance. It is used with human or animal concepts but should be differentiated from SEX CHARACTERISTICS, anatomical or physiological manifestations of sex, and from SEX DISTRIBUTION, the number of males and females in given circumstances.Reference Values: The range or frequency distribution of a measurement in a population (of organisms, organs or things) that has not been selected for the presence of disease or abnormality.Insulin Infusion Systems: Portable or implantable devices for infusion of insulin. Includes open-loop systems which may be patient-operated or controlled by a pre-set program and are designed for constant delivery of small quantities of insulin, increased during food ingestion, and closed-loop systems which deliver quantities of insulin automatically based on an electronic glucose sensor.Body Weight: The mass or quantity of heaviness of an individual. It is expressed by units of pounds or kilograms.Fructosamine: An amino sugar formed when glucose non-enzymatically reacts with the N-terminal amino group of proteins. The fructose moiety is derived from glucose by the "classical" Amadori rearrangement.Logistic Models: Statistical models which describe the relationship between a qualitative dependent variable (that is, one which can take only certain discrete values, such as the presence or absence of a disease) and an independent variable. A common application is in epidemiology for estimating an individual's risk (probability of a disease) as a function of a given risk factor.Lipids: A generic term for fats and lipoids, the alcohol-ether-soluble constituents of protoplasm, which are insoluble in water. They comprise the fats, fatty oils, essential oils, waxes, phospholipids, glycolipids, sulfolipids, aminolipids, chromolipids (lipochromes), and fatty acids. (Grant & Hackh's Chemical Dictionary, 5th ed)Dipeptidyl-Peptidase IV Inhibitors: Compounds that suppress the degradation of INCRETINS by blocking the action of DIPEPTIDYL-PEPTIDASE IV. This helps to correct the defective INSULIN and GLUCAGON secretion characteristic of TYPE 2 DIABETES MELLITUS by stimulating insulin secretion and suppressing glucagon release.JapanTriglyceridesCoronary Artery Disease: Pathological processes of CORONARY ARTERIES that may derive from a congenital abnormality, atherosclerotic, or non-atherosclerotic cause.Diabetic Foot: Common foot problems in persons with DIABETES MELLITUS, caused by any combination of factors such as DIABETIC NEUROPATHIES; PERIPHERAL VASCULAR DISEASES; and INFECTION. With the loss of sensation and poor circulation, injuries and infections often lead to severe foot ulceration, GANGRENE and AMPUTATION.Odds Ratio: The ratio of two odds. The exposure-odds ratio for case control data is the ratio of the odds in favor of exposure among cases to the odds in favor of exposure among noncases. The disease-odds ratio for a cohort or cross section is the ratio of the odds in favor of disease among the exposed to the odds in favor of disease among the unexposed. The prevalence-odds ratio refers to an odds ratio derived cross-sectionally from studies of prevalent cases.Genetic Predisposition to Disease: A latent susceptibility to disease at the genetic level, which may be activated under certain conditions.Regression Analysis: Procedures for finding the mathematical function which best describes the relationship between a dependent variable and one or more independent variables. In linear regression (see LINEAR MODELS) the relationship is constrained to be a straight line and LEAST-SQUARES ANALYSIS is used to determine the best fit. In logistic regression (see LOGISTIC MODELS) the dependent variable is qualitative rather than continuously variable and LIKELIHOOD FUNCTIONS are used to find the best relationship. In multiple regression, the dependent variable is considered to depend on more than a single independent variable.Pancreas: A nodular organ in the ABDOMEN that contains a mixture of ENDOCRINE GLANDS and EXOCRINE GLANDS. The small endocrine portion consists of the ISLETS OF LANGERHANS secreting a number of hormones into the blood stream. The large exocrine portion (EXOCRINE PANCREAS) is a compound acinar gland that secretes several digestive enzymes into the pancreatic ductal system that empties into the DUODENUM.Hyperlipidemias: Conditions with excess LIPIDS in the blood.Dyslipidemias: Abnormalities in the serum levels of LIPIDS, including overproduction or deficiency. Abnormal serum lipid profiles may include high total CHOLESTEROL, high TRIGLYCERIDES, low HIGH DENSITY LIPOPROTEIN CHOLESTEROL, and elevated LOW DENSITY LIPOPROTEIN CHOLESTEROL.Glucagon-Like Peptide 1: A peptide of 36 or 37 amino acids that is derived from PROGLUCAGON and mainly produced by the INTESTINAL L CELLS. GLP-1(1-37 or 1-36) is further N-terminally truncated resulting in GLP-1(7-37) or GLP-1-(7-36) which can be amidated. These GLP-1 peptides are known to enhance glucose-dependent INSULIN release, suppress GLUCAGON release and gastric emptying, lower BLOOD GLUCOSE, and reduce food intake.Predictive Value of Tests: In screening and diagnostic tests, the probability that a person with a positive test is a true positive (i.e., has the disease), is referred to as the predictive value of a positive test; whereas, the predictive value of a negative test is the probability that the person with a negative test does not have the disease. Predictive value is related to the sensitivity and specificity of the test.Proportional Hazards Models: Statistical models used in survival analysis that assert that the effect of the study factors on the hazard rate in the study population is multiplicative and does not change over time.Glycosuria: The appearance of an abnormally large amount of GLUCOSE in the urine, such as more than 500 mg/day in adults. It can be due to HYPERGLYCEMIA or genetic defects in renal reabsorption (RENAL GLYCOSURIA).Self Care: Performance of activities or tasks traditionally performed by professional health care providers. The concept includes care of oneself or one's family and friends.Asian Continental Ancestry Group: Individuals whose ancestral origins are in the southeastern and eastern areas of the Asian continent.Kidney Failure, Chronic: The end-stage of CHRONIC RENAL INSUFFICIENCY. It is characterized by the severe irreversible kidney damage (as measured by the level of PROTEINURIA) and the reduction in GLOMERULAR FILTRATION RATE to less than 15 ml per min (Kidney Foundation: Kidney Disease Outcome Quality Initiative, 2002). These patients generally require HEMODIALYSIS or KIDNEY TRANSPLANTATION.Autoantibodies: Antibodies that react with self-antigens (AUTOANTIGENS) of the organism that produced them.Glucose Clamp Technique: Maintenance of a constant blood glucose level by perfusion or infusion with glucose or insulin. It is used for the study of metabolic rates (e.g., in glucose, lipid, amino acid metabolism) at constant glucose concentration.Chi-Square Distribution: A distribution in which a variable is distributed like the sum of the squares of any given independent random variable, each of which has a normal distribution with mean of zero and variance of one. The chi-square test is a statistical test based on comparison of a test statistic to a chi-square distribution. The oldest of these tests are used to detect whether two or more population distributions differ from one another.Life Style: Typical way of life or manner of living characteristic of an individual or group. (From APA, Thesaurus of Psychological Index Terms, 8th ed)Genotype: The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.Islet Amyloid Polypeptide: A pancreatic beta-cell hormone that is co-secreted with INSULIN. It displays an anorectic effect on nutrient metabolism by inhibiting gastric acid secretion, gastric emptying and postprandial GLUCAGON secretion. Islet amyloid polypeptide can fold into AMYLOID FIBRILS that have been found as a major constituent of pancreatic AMYLOID DEPOSITS.Postprandial Period: The time frame after a meal or FOOD INTAKE.Questionnaires: Predetermined sets of questions used to collect data - clinical data, social status, occupational group, etc. The term is often applied to a self-completed survey instrument.Indians, North American: Individual members of North American ethnic groups with ancient historic ancestral origins in Asia.Disease Progression: The worsening of a disease over time. This concept is most often used for chronic and incurable diseases where the stage of the disease is an important determinant of therapy and prognosis.Coronary Disease: An imbalance between myocardial functional requirements and the capacity of the CORONARY VESSELS to supply sufficient blood flow. It is a form of MYOCARDIAL ISCHEMIA (insufficient blood supply to the heart muscle) caused by a decreased capacity of the coronary vessels.Islets of Langerhans Transplantation: The transference of pancreatic islets within an individual, between individuals of the same species, or between individuals of different species.Risk: The probability that an event will occur. It encompasses a variety of measures of the probability of a generally unfavorable outcome.Disease Management: A broad approach to appropriate coordination of the entire disease treatment process that often involves shifting away from more expensive inpatient and acute care to areas such as preventive medicine, patient counseling and education, and outpatient care. This concept includes implications of appropriate versus inappropriate therapy on the overall cost and clinical outcome of a particular disease. (From Hosp Pharm 1995 Jul;30(7):596)Proinsulin: A pancreatic polypeptide of about 110 amino acids, depending on the species, that is the precursor of insulin. Proinsulin, produced by the PANCREATIC BETA CELLS, is comprised sequentially of the N-terminal B-chain, the proteolytically removable connecting C-peptide, and the C-terminal A-chain. It also contains three disulfide bonds, two between A-chain and B-chain. After cleavage at two locations, insulin and C-peptide are the secreted products. Intact proinsulin with low bioactivity also is secreted in small amounts.Analysis of Variance: A statistical technique that isolates and assesses the contributions of categorical independent variables to variation in the mean of a continuous dependent variable.Glucagon: A 29-amino acid pancreatic peptide derived from proglucagon which is also the precursor of intestinal GLUCAGON-LIKE PEPTIDES. Glucagon is secreted by PANCREATIC ALPHA CELLS and plays an important role in regulation of BLOOD GLUCOSE concentration, ketone metabolism, and several other biochemical and physiological processes. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1511)Wolfram Syndrome: A hereditary condition characterized by multiple symptoms including those of DIABETES INSIPIDUS; DIABETES MELLITUS; OPTIC ATROPHY; and DEAFNESS. This syndrome is also known as DIDMOAD (first letter of each word) and is usually associated with VASOPRESSIN deficiency. It is caused by mutations in gene WFS1 encoding wolframin, a 100-kDa transmembrane protein.Sex Distribution: The number of males and females in a given population. The distribution may refer to how many men or women or what proportion of either in the group. The population is usually patients with a specific disease but the concept is not restricted to humans and is not restricted to medicine.Disease Models, Animal: Naturally occurring or experimentally induced animal diseases with pathological processes sufficiently similar to those of human diseases. They are used as study models for human diseases.Severity of Illness Index: Levels within a diagnostic group which are established by various measurement criteria applied to the seriousness of a patient's disorder.Adiponectin: A 30-kDa COMPLEMENT C1Q-related protein, the most abundant gene product secreted by FAT CELLS of the white ADIPOSE TISSUE. Adiponectin modulates several physiological processes, such as metabolism of GLUCOSE and FATTY ACIDS, and immune responses. Decreased plasma adiponectin levels are associated with INSULIN RESISTANCE; TYPE 2 DIABETES MELLITUS; OBESITY; and ATHEROSCLEROSIS.Patient Education as Topic: The teaching or training of patients concerning their own health needs.Incretins: Peptides which stimulate INSULIN release from the PANCREATIC BETA CELLS following oral nutrient ingestion, or postprandially.Oxidative Stress: A disturbance in the prooxidant-antioxidant balance in favor of the former, leading to potential damage. Indicators of oxidative stress include damaged DNA bases, protein oxidation products, and lipid peroxidation products (Sies, Oxidative Stress, 1991, pxv-xvi).Glomerular Filtration Rate: The volume of water filtered out of plasma through glomerular capillary walls into Bowman's capsules per unit of time. It is considered to be equivalent to INULIN clearance.Venoms: Poisonous animal secretions forming fluid mixtures of many different enzymes, toxins, and other substances. These substances are produced in specialized glands and secreted through specialized delivery systems (nematocysts, spines, fangs, etc.) for disabling prey or predator.Prognosis: A prediction of the probable outcome of a disease based on a individual's condition and the usual course of the disease as seen in similar situations.Hyperinsulinism: A syndrome with excessively high INSULIN levels in the BLOOD. It may cause HYPOGLYCEMIA. Etiology of hyperinsulinism varies, including hypersecretion of a beta cell tumor (INSULINOMA); autoantibodies against insulin (INSULIN ANTIBODIES); defective insulin receptor (INSULIN RESISTANCE); or overuse of exogenous insulin or HYPOGLYCEMIC AGENTS.Cholesterol, HDL: Cholesterol which is contained in or bound to high-density lipoproteins (HDL), including CHOLESTEROL ESTERS and free cholesterol.Age Distribution: The frequency of different ages or age groups in a given population. The distribution may refer to either how many or what proportion of the group. The population is usually patients with a specific disease but the concept is not restricted to humans and is not restricted to medicine.Myocardial Infarction: NECROSIS of the MYOCARDIUM caused by an obstruction of the blood supply to the heart (CORONARY CIRCULATION).Cholesterol: The principal sterol of all higher animals, distributed in body tissues, especially the brain and spinal cord, and in animal fats and oils.Antihypertensive Agents: Drugs used in the treatment of acute or chronic vascular HYPERTENSION regardless of pharmacological mechanism. Among the antihypertensive agents are DIURETICS; (especially DIURETICS, THIAZIDE); ADRENERGIC BETA-ANTAGONISTS; ADRENERGIC ALPHA-ANTAGONISTS; ANGIOTENSIN-CONVERTING ENZYME INHIBITORS; CALCIUM CHANNEL BLOCKERS; GANGLIONIC BLOCKERS; and VASODILATOR AGENTS.CreatinineAtherosclerosis: A thickening and loss of elasticity of the walls of ARTERIES that occurs with formation of ATHEROSCLEROTIC PLAQUES within the ARTERIAL INTIMA.Diabetes Mellitus, Lipoatrophic: A type of diabetes mellitus that is characterized by severe INSULIN RESISTANCE and LIPODYSTROPHY. The latter may be generalized, partial, acquired, or congenital (LIPODYSTROPHY, CONGENITAL GENERALIZED).Polymorphism, Single Nucleotide: A single nucleotide variation in a genetic sequence that occurs at appreciable frequency in the population.Chronic Disease: Diseases which have one or more of the following characteristics: they are permanent, leave residual disability, are caused by nonreversible pathological alteration, require special training of the patient for rehabilitation, or may be expected to require a long period of supervision, observation, or care. (Dictionary of Health Services Management, 2d ed)Age of Onset: The age, developmental stage, or period of life at which a disease or the initial symptoms or manifestations of a disease appear in an individual.Cholesterol, LDL: Cholesterol which is contained in or bound to low density lipoproteins (LDL), including CHOLESTEROL ESTERS and free cholesterol.Diet: Regular course of eating and drinking adopted by a person or animal.HLA-DQ Antigens: A group of the D-related HLA antigens found to differ from the DR antigens in genetic locus and therefore inheritance. These antigens are polymorphic glycoproteins comprising alpha and beta chains and are found on lymphoid and other cells, often associated with certain diseases.Polymorphism, Genetic: The regular and simultaneous occurrence in a single interbreeding population of two or more discontinuous genotypes. The concept includes differences in genotypes ranging in size from a single nucleotide site (POLYMORPHISM, SINGLE NUCLEOTIDE) to large nucleotide sequences visible at a chromosomal level.Infant, Newborn: An infant during the first month after birth.Glycosylation End Products, Advanced: Products derived from the nonenzymatic reaction of GLUCOSE and PROTEINS in vivo that exhibit a yellow-brown pigmentation and an ability to participate in protein-protein cross-linking. These substances are involved in biological processes relating to protein turnover and it is believed that their excessive accumulation contributes to the chronic complications of DIABETES MELLITUS.Longitudinal Studies: Studies in which variables relating to an individual or group of individuals are assessed over a period of time.Diabetic Cardiomyopathies: Diabetes complications in which VENTRICULAR REMODELING in the absence of CORONARY ATHEROSCLEROSIS and hypertension results in cardiac dysfunctions, typically LEFT VENTRICULAR DYSFUNCTION. The changes also result in myocardial hypertrophy, myocardial necrosis and fibrosis, and collagen deposition due to impaired glucose tolerance.Endocrinology: A subspecialty of internal medicine concerned with the metabolism, physiology, and disorders of the ENDOCRINE SYSTEM.Drug Therapy, Combination: Therapy with two or more separate preparations given for a combined effect.Adamantane: A tricyclo bridged hydrocarbon.Pancreas Transplantation: The transference of a pancreas from one human or animal to another.Rats, Zucker: Two populations of Zucker rats have been cited in research--the "fatty" or obese and the lean. The "fatty" rat (Rattus norvegicus) appeared as a spontaneous mutant. The obese condition appears to be due to a single recessive gene.Weight Loss: Decrease in existing BODY WEIGHT.ArizonaConfidence Intervals: A range of values for a variable of interest, e.g., a rate, constructed so that this range has a specified probability of including the true value of the variable.Exercise: Physical activity which is usually regular and done with the intention of improving or maintaining PHYSICAL FITNESS or HEALTH. Contrast with PHYSICAL EXERTION which is concerned largely with the physiologic and metabolic response to energy expenditure.Linear Models: Statistical models in which the value of a parameter for a given value of a factor is assumed to be equal to a + bx, where a and b are constants. The models predict a linear regression.Smoking: Inhaling and exhaling the smoke of burning TOBACCO.Glycemic Index: A numerical system of measuring the rate of BLOOD GLUCOSE generation from a particular food item as compared to a reference item, such as glucose = 100. Foods with higher glycemic index numbers create greater blood sugar swings.Rats, Wistar: A strain of albino rat developed at the Wistar Institute that has spread widely at other institutions. This has markedly diluted the original strain.Kidney: Body organ that filters blood for the secretion of URINE and that regulates ion concentrations.Rats, Inbred OLETF: An inbred strain of Long-Evans rats that develops hyperglycemia, hyperinsulinemia, and mild obesity, mostly in males, that resembles non-insulin-dependent diabetes mellitus in humans. It was developed from outbred Long-Evans stock in 1983.HLA-DQ beta-Chains: Transmembrane proteins that form the beta subunits of the HLA-DQ antigens.Hypolipidemic Agents: Substances that lower the levels of certain LIPIDS in the BLOOD. They are used to treat HYPERLIPIDEMIAS.Stroke: A group of pathological conditions characterized by sudden, non-convulsive loss of neurological function due to BRAIN ISCHEMIA or INTRACRANIAL HEMORRHAGES. Stroke is classified by the type of tissue NECROSIS, such as the anatomic location, vasculature involved, etiology, age of the affected individual, and hemorrhagic vs. non-hemorrhagic nature. (From Adams et al., Principles of Neurology, 6th ed, pp777-810)Mass Screening: Organized periodic procedures performed on large groups of people for the purpose of detecting disease.Registries: The systems and processes involved in the establishment, support, management, and operation of registers, e.g., disease registers.Double-Blind Method: A method of studying a drug or procedure in which both the subjects and investigators are kept unaware of who is actually getting which specific treatment.C-Reactive Protein: A plasma protein that circulates in increased amounts during inflammation and after tissue damage.Alleles: Variant forms of the same gene, occupying the same locus on homologous CHROMOSOMES, and governing the variants in production of the same gene product.Endothelium, Vascular: Single pavement layer of cells which line the luminal surface of the entire vascular system and regulate the transport of macromolecules and blood components.China: A country spanning from central Asia to the Pacific Ocean.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.African Continental Ancestry Group: Individuals whose ancestral origins are in the continent of Africa.Autonomic Nervous System Diseases: Diseases of the parasympathetic or sympathetic divisions of the AUTONOMIC NERVOUS SYSTEM; which has components located in the CENTRAL NERVOUS SYSTEM and PERIPHERAL NERVOUS SYSTEM. Autonomic dysfunction may be associated with HYPOTHALAMIC DISEASES; BRAIN STEM disorders; SPINAL CORD DISEASES; and PERIPHERAL NERVOUS SYSTEM DISEASES. Manifestations include impairments of vegetative functions including the maintenance of BLOOD PRESSURE; HEART RATE; pupil function; SWEATING; REPRODUCTIVE AND URINARY PHYSIOLOGY; and DIGESTION.Fetal Macrosomia: A condition of fetal overgrowth leading to a large-for-gestational-age FETUS. It is defined as BIRTH WEIGHT greater than 4,000 grams or above the 90th percentile for population and sex-specific growth curves. It is commonly seen in GESTATIONAL DIABETES; PROLONGED PREGNANCY; and pregnancies complicated by pre-existing diabetes mellitus.Aging: The gradual irreversible changes in structure and function of an organism that occur as a result of the passage of time.Patient Compliance: Voluntary cooperation of the patient in following a prescribed regimen.Transcription Factor 7-Like 2 Protein: A transcription factor that takes part in WNT signaling pathway. The activity of the protein is regulated via its interaction with BETA CATENIN. Transcription factor 7-like 2 protein plays an important role in the embryogenesis of the PANCREAS and ISLET CELLS.Adipose Tissue: Specialized connective tissue composed of fat cells (ADIPOCYTES). It is the site of stored FATS, usually in the form of TRIGLYCERIDES. In mammals, there are two types of adipose tissue, the WHITE FAT and the BROWN FAT. Their relative distributions vary in different species with most adipose tissue being white.Gliclazide: An oral sulfonylurea hypoglycemic agent which stimulates insulin secretion.Metabolic Diseases: Generic term for diseases caused by an abnormal metabolic process. It can be congenital due to inherited enzyme abnormality (METABOLISM, INBORN ERRORS) or acquired due to disease of an endocrine organ or failure of a metabolically important organ such as the liver. (Stedman, 26th ed)Autoimmunity: Process whereby the immune system reacts against the body's own tissues. Autoimmunity may produce or be caused by AUTOIMMUNE DISEASES.Rats, Sprague-Dawley: A strain of albino rat used widely for experimental purposes because of its calmness and ease of handling. It was developed by the Sprague-Dawley Animal Company.Randomized Controlled Trials as Topic: Works about clinical trials that involve at least one test treatment and one control treatment, concurrent enrollment and follow-up of the test- and control-treated groups, and in which the treatments to be administered are selected by a random process, such as the use of a random-numbers table.Health Surveys: A systematic collection of factual data pertaining to health and disease in a human population within a given geographic area.Malaysia: A parliamentary democracy with a constitutional monarch in southeast Asia, consisting of 11 states (West Malaysia) on the Malay Peninsula and two states (East Malaysia) on the island of BORNEO. It is also called the Federation of Malaysia. Its capital is Kuala Lumpur. Before 1963 it was the Union of Malaya. It reorganized in 1948 as the Federation of Malaya, becoming independent from British Malaya in 1957 and becoming Malaysia in 1963 as a federation of Malaya, Sabah, Sarawak, and Singapore (which seceded in 1965). The form Malay- probably derives from the Tamil malay, mountain, with reference to its geography. (From Webster's New Geographical Dictionary, 1988, p715 & Room, Brewer's Dictionary of Names, 1992, p329)Autoimmune Diseases: Disorders that are characterized by the production of antibodies that react with host tissues or immune effector cells that are autoreactive to endogenous peptides.Gene Frequency: The proportion of one particular in the total of all ALLELES for one genetic locus in a breeding POPULATION.Hypercholesterolemia: A condition with abnormally high levels of CHOLESTEROL in the blood. It is defined as a cholesterol value exceeding the 95th percentile for the population.Gastroparesis: Chronic delayed gastric emptying. Gastroparesis may be caused by motor dysfunction or paralysis of STOMACH muscles or may be associated with other systemic diseases such as DIABETES MELLITUS.Insulin Antibodies: Antibodies specific to INSULIN.Kidney Transplantation: The transference of a kidney from one human or animal to another.Homeostasis: The processes whereby the internal environment of an organism tends to remain balanced and stable.Leptin: A 16-kDa peptide hormone secreted from WHITE ADIPOCYTES. Leptin serves as a feedback signal from fat cells to the CENTRAL NERVOUS SYSTEM in regulation of food intake, energy balance, and fat storage.Postpartum Period: In females, the period that is shortly after giving birth (PARTURITION).Primary Health Care: Care which provides integrated, accessible health care services by clinicians who are accountable for addressing a large majority of personal health care needs, developing a sustained partnership with patients, and practicing in the context of family and community. (JAMA 1995;273(3):192)Practice Guidelines as Topic: Directions or principles presenting current or future rules of policy for assisting health care practitioners in patient care decisions regarding diagnosis, therapy, or related clinical circumstances. The guidelines may be developed by government agencies at any level, institutions, professional societies, governing boards, or by the convening of expert panels. The guidelines form a basis for the evaluation of all aspects of health care and delivery.Weight Gain: Increase in BODY WEIGHT over existing weight.IndiaLipid Metabolism: Physiological processes in biosynthesis (anabolism) and degradation (catabolism) of LIPIDS.Insulin, Long-Acting: Insulin formulations that contain substances that retard absorption thus extending the time period of action.Netherlands: Country located in EUROPE. It is bordered by the NORTH SEA, BELGIUM, and GERMANY. Constituent areas are Aruba, Curacao, Sint Maarten, formerly included in the NETHERLANDS ANTILLES.Pilot Projects: Small-scale tests of methods and procedures to be used on a larger scale if the pilot study demonstrates that these methods and procedures can work.Receptor-Like Protein Tyrosine Phosphatases, Class 8: A subclass of receptor-like protein tryosine phosphatases that contain an extracellular RDGS-adhesion recognition motif and a single cytosolic protein tyrosine phosphate domain.Fatty Acids, Nonesterified: FATTY ACIDS found in the plasma that are complexed with SERUM ALBUMIN for transport. These fatty acids are not in glycerol ester form.Renal Dialysis: Therapy for the insufficient cleansing of the BLOOD by the kidneys based on dialysis and including hemodialysis, PERITONEAL DIALYSIS, and HEMODIAFILTRATION.Obesity, Morbid: The condition of weighing two, three, or more times the ideal weight, so called because it is associated with many serious and life-threatening disorders. In the BODY MASS INDEX, morbid obesity is defined as having a BMI greater than 40.0 kg/m2.Kidney Diseases: Pathological processes of the KIDNEY or its component tissues.Protein Tyrosine Phosphatase, Non-Receptor Type 1: A subtype of non-receptor protein tyrosine phosphatases that includes two distinctive targeting motifs; an N-terminal motif specific for the INSULIN RECEPTOR, and a C-terminal motif specific for the SH3 domain containing proteins. This subtype includes a hydrophobic domain which localizes it to the ENDOPLASMIC RETICULUM.Chlorpropamide: A sulfonylurea hypoglycemic agent used in the treatment of non-insulin-dependent diabetes mellitus not responding to dietary modification. (From Martindale, The Extra Pharmacopoeia, 30th ed, p277)Sodium-Glucose Transporter 2: A sodium-glucose transporter that is expressed in the luminal membrane of the PROXIMAL KIDNEY TUBULES.

*  Multivessel coronary artery disease revascularisation strategies in patients...
Multivessel coronary artery disease revascularisation strategies in patients with diabetes mellitus. Email alerts ...
http://heart.bmj.com/content/early/2013/03/07/heartjnl-2013-303820.full
*  The antioxidant role of pterostilbene in streptozotocin-nicotinamide-induced...
Patients and/or caregivers may access this content for use in relation to their own personal healthcare or that of a family member only. Terms and conditions will apply. ...
http://onlinelibrary.wiley.com/doi/10.1211/jpp.58.11.0009/pdf
*  Ankle pressures in UK South Asians with diabetes mellitus: a case control study...
Ankle pressures in UK South Asians with diabetes mellitus: a case control study ... Ankle pressures in UK South Asians with diabetes mellitus: a case control study ... To study ethnic differences in ankle pressures in South Asians versus Europeans and in those with and without diabetes mellitus ... Prospective studies on ankle pressures for development of diabetes or cardiovascular disease are warranted in South Asians. ...
http://heart.bmj.com/content/99/9/614.full
*  British Library EThOS: Ethnic differences in antioxidant defence in patients...
Ethnic differences in antioxidant defence in patients with type 2 diabetes mellitus ...
http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.425360
*  Sabinet | National Guidelines at a glance : Type 2 Diabetes Mellitus : review
Type 1 diabetes was formerly known as insulin-dependent diabetes, and Type 2 diabetes (the focus of this article) as non- ... insulin dependent diabetes. Type 2 diabetes accounts for 85-95% of all diabetes cases. ... Diabetes mellitus is a group of metabolic conditions characterised by raised blood glucose levels, caused by inadequate insulin ... Type 1 diabetes was formerly known as insulin-dependent diabetes, and Type 2 diabetes (the focus of this article) as non- ...
http://journals.co.za/content/mp_sapj/76/10/EJC82098
*  Atkins Diet Causes Diabetic Ketoacidosis in Diabetes Mellitus Sufferers ·...
If you do have diabetes mellitus and you're trying to lose weight, the best way to do that would be to just eat healthy, eat ... Atkins Diet Causes Diabetic Ketoacidosis in Diabetes Mellitus Sufferers By Jim Donahue on December 12, 2012. 5 Comments ... The bottom line is this, if you have diabetes mellitus and you want to lose weight, you may find yourself with more problems ... Diabetic ketoacidosis is less likely to occur in those who have diabetes mellitus type II, and is more common in the African
http://guardianlv.com/2012/12/atkins-diet-causes-diabetic-ketoacidosis-in-diabetes-mellitus-sufferers/
*  Altered Insulin Receptor Signalling and β-Cell Cycle Dynamics in Type 2...
... and hyperglucagonemia are consistent features in type 2 diabetes mellitus (T2DM). We used pancreas and islets from humans with ... Diabetes mellitus Is the Subject Area "Diabetes mellitus" applicable to this article? Yes. No. ... Type 2 diabetes Is the Subject Area "Type 2 diabetes" applicable to this article? Yes. No. ...
http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0028050
*  Diabetes mellitus | BioMedNews.org
Blood sugarDiabetes mellitusDiabetes mellitus type 2diabetes treatmentobesitytechnology for treating diabetestexting for ... Tag Archives: Diabetes mellitus. diabetes, health apps, health dangers Text messaging apps can improve diabetes self-care. ... you may be glad to learn that that method of reaching out to people with diabetes can significantly improve several aspects of ... 1 million people in India where diabetes is even more rampant than in the U.S. So far the results are impressive - ...
http://biomednews.org/tag/diabetes-mellitus/
*  Insulin, Glucagon, and Diabetes Mellitus
... insulin-dependent diabetes mellitus (IDDM) type II - non-insulin-dependent diabetes mellitus (NIDDM, insulin resistance ... usual onset of type I diabetes occurs at about 14 years of age - juvenile diabetes mellitus may develop abruptly (few days or ... Insulin, Glucagon, and Diabetes Mellitus Prof. dr. Zoran Valić Department of Physiology University of Split School of Medicine ... especially to blood vessels Diabetes Mellitus   syndrome of impaired carbohydrate, fat, and protein metabolism,
http://slidegur.com/doc/142948/insulin--glucagon--and-diabetes-mellitus
*  Canine Diabetes Mellitus | Common Dog Diseases
Canine diabetes mellitus occurs when the pancreas doesn't produce enough insulin. Sometimes the pancreas will produce enough ... Canine diabetes mellitus occurs when the pancreas doesn't produce enough insulin. Sometimes the pancreas will produce enough ... You should be aware that canine diabetes mellitus cannot be cured. The disease can only be managed. Your dog will likely need ... Other diseases can cause some of the same symptoms as canine diabetes mellitus. If the vet suspects that your dog's ...
http://common-dog-diseases.com/canine-diabetes-mellitus/
*  Chapter 33 - Part 1 - Diabetes Mellitus: Overview and Types 1 and 2 flashcards | Quizlet
. . .  Create a Study Set. Log In .  Log In with Google.  Log In with Facebook. Log In Forgot password. Study Study  only  Flashcards. Play Play  only  Scatter. . .  Like this study set. Sign up for an account  Sign up with Google. . . . . . . Study 0  term terms only  . .  . .  . Occurs primarily in children and young adults Type 1 - Insulin-dependent diabetes mellitus IDDM : 1. Polyuria Advanced signs of Type 1 - Insulin-dependent diabetes mellitus IDDM : 1. Polyphagia Advanced signs of Type 1 - Insulin-dependent diabetes mellitus IDDM : 2. Polydipsia Advanced signs of Type 1 - Insulin-dependent diabetes mellitus IDDM : 3. Hyperglycemia Advanced signs of Type 1 - Insulin-dependent diabetes mellitus ...
https://quizlet.com/16262156/chapter-33-part-1-diabetes-mellitus-overview-and-types-1-and-2-flash-cards/
*  Search of: "Diabetes Mellitus" - List Results - ClinicalTrials.gov
Rank Status Study 1 Completed PROCHYMAL Human Adult Stem Cells for the Treatment of Recently Diagnosed Type 1 Diabetes Mellitus T1DM. Conditions: Type 1 Diabetes Mellitus; Type 1 Diabetes; Diabetes Mellitus, Insulin-Dependent; Juvenile Diabetes. Conditions: Diabetes Mellitus, Type 2; Diabetes Mellitus, Adult-Onset; Diabetes Mellitus, Non-Insulin-Dependent; Diabetes Mellitus, Noninsulin Dependent; Diabetes Mellitus, Type II. Interventions: Drug: Metformin XR plus placebo; Drug: Metformin XR plus liraglutide. Conditions: Type 1 Diabetes Mellitus; Type 2 Diabetes Mellitus; Hypercholesterolemia. Interventions: Behavioral: Education on risk factors for Type II Diabetes; Behavioral: Education on Type II Diabetes; Behavioral: Education on regular visits to a Primary Care Provider. Conditions: Diabetes Mellitus; Diabetes ...
https://clinicaltrials.gov/ct2/results?cond="Diabetes Mellitus"&show_flds=Y
*  .. Ramadan Fasting and Diabetes Mellitus
Ramadan Fasting and Diabetes Mellitus By: Fereidoun Azizi Md. diabetes, fasting, ramadan. It is also critical that diabetics adjust their drug treatments, particularly those patients diagnosed with insulin dependent diabetes mellitus IDDM. We named these three important factors — drug regimen adjustment, diet control and daily activity — the “Ramadan 3D Triangle.” With 3D attention, proper education and diabetic management, we conclude that most non-insulin dependent diabetes mellitus NIDDM patients and occasional IDDM patients who insist on fasting can carefully observe Ramadan. Few studies have shown the effect of Ramadan fasting on serum glucose. Body weight during Ramadan fasting. b In diabetics:. Most patients show no significant change in their glucose control. Most patients with non-insulin dependent diabetes mellitus NIDDM, diabetes type II and insulin dependent diabetes mellitus IDDM, diabetes type I show no ...
http://islamicity.org/1896/ramadan-fasting-and-diabetes-mellitus/
*  Diabetes mellitus type 2
... 1 Diabetes mellitus type 2 Common Name s Diabetes mellitus type 2, Type 2 diabetes. Type 2 diabetes mellitus is a metabolic disease in which a person has high blood sugar or glucose levels. Therefore lack of insulin or the inability of cells to recognize insulin results in increased or high blood glucose levels. Advocacy and Support Organizations. Advocacy and Support Organizations. Condition Specific Organizations Following organizations serve the condition "Diabetes mellitus type 2" for support, advocacy or research. Last Updated: 6 Mar 2013 View Details. Last Updated: 28 Mar 2013 View Details. General Support Organizations Not finding the support you need. Show General Support Organizations. Advocacy and Support Organizations. Condition Specific Organizations Following organizations serve the condition "Diabetes mellitus type 2" for support, advocacy or research. General Support Organizations Not finding the support you ...
http://diseaseinfosearch.org/result/8215
*  Systematic Review: Comparative Effectiveness and Safety of Oral Medications for Type 2 Diabetes M
Systematic Review: Comparative Effectiveness and Safety of Oral Medications for Type 2 Diabetes Mellitus. Systematic Review: Comparative Effectiveness and Safety of Oral Medications for Type 2 Diabetes Mellitus. Table Jump Placeholder Table 1. Evidence of the Comparative Effectiveness of Oral Diabetes Medications on Mortality, Microvascular and Macrovascular Outcomes, and Intermediate End Points. However, rates of lactic acidosis were similar between metformin and other oral diabetes agents, according to a systematic review of 176 comparative trials 35. Table Jump Placeholder Table 2. Adverse Effects Related to Oral Diabetes Medications in Head-to-Head Comparisons. However, neither our review nor that of Salpeter and colleagues 35 found evidence of an elevated risk for lactic acidosis in patients taking metformin compared with other oral diabetes agents. et al. Glycemic control and macrovascular disease in types 1 and 2 diabetes mellitus: ...
http://annals.org/article.aspx?articleid=736504
*  Glycemic Control and Complications in Diabetes Mellitus Type 2 (VADT) - Study Results - ClinicalTria
Glycemic Control and Complications in Diabetes Mellitus Type 2 VADT - Study Results - ClinicalTrials.gov. Glycemic Control and Complications in Diabetes Mellitus Type 2 VADT This study has been completed. Type 2 Diabetes Mellitus. Drug: Insulin Drug: Glimepiride Drug: Rosiglitazone Drug: Metformin. Intensive Glycemic Control Intensive glycemic control lower HbA1c below 6.0%. Standard Glycemic Control. Description Arm 1/Standard Glycemic Control Standard glycemic control to maintain HbA1c between 8.0-9.0%. Arm 2/Intensive Glycemic Control Intensive glycemic control lower HbA1c below 6.0%. Glucose control and vascular complications in veterans with type 2 diabetes. Emanuele N, Moritz T, Klein R, Davis MD, Glander K, Khanna A, Thottapurathu L, Bahn G, Duckworth W, Abraira C; Veterans Affairs Diabetes Trial Study Group. Emanuele N, Klein R, Moritz T, Davis MD, Glander K, Anderson R, Reda D, Duckworth W, Abraira C; VADT Study Group. Emanuele N, Sacks J, ...
https://clinicaltrials.gov/ct2/show/results/NCT00032487?view=record
*  Diabetes mellitus type 2
... 'Diabetes mellitus type 2' formerly 'noninsulin-dependent diabetes mellitus NIDDM ' or 'adult-onset diabetes' is a metabolic disorder that is characterized by hyperglycemia high blood sugar in the context of insulin resistance and relative lack of insulin. Type 2 diabetes makes up about 90% of cases of diabetes, with the other 10% due primarily to diabetes mellitus type 1 and gestational diabetes. Pathophysiology Diagnosis Screening Prevention Management Lifestyle. Lifestyle causes of diabetes mellitus type 2. Those who have previously had gestational diabetes are at a higher risk of developing type 2 diabetes. fasting plasma glucose ≥ 7.0 mmol/l 126 mg/dl :or with a glucose tolerance test, two hours after the oral dose a plasma glucose ≥ 11.1 mmol/l 200 mg/dl A random blood sugar of greater than 11.1 mmol/l 200 mg/dL in association with typical symptoms or a glycated hemoglobin HbA 1c of ≥ 48 mmol/mol ≥ ...
https://en.wikipedia.org/wiki/Diabetes_mellitus_type_2
*  Prandin Monograph for Professionals - Drugs.com
Prandin. Prandin. Uses for Prandin. Diabetes Mellitus. to improve glycemic control in patients with type 2 diabetes mellitus who do not respond adequately to therapy with one or more oral antidiabetic agents. Prandin Dosage and Administration. 71 However, the American Diabetes Association ADA states that most pediatric diabetologists use oral antidiabetic agents in children with type 2 diabetes mellitus because of greater patient compliance and convenience for the patient s family. May cause hyperglycemia and exacerbate glycemic control in patients with diabetes mellitus 1. May cause hyperglycemia and exacerbate glycemic control in patients with diabetes mellitus 1. May cause hyperglycemia and exacerbate glycemic control in patients with diabetes mellitus 1. May cause hyperglycemia and exacerbate glycemic control in patients with diabetes mellitus 1. May cause hyperglycemia and may exacerbate glycemic ...
http://drugs.com/monograph/prandin.html
*  Cardiology and cardiac surgery | Medical Journal of Australia
Cardiology and cardiac surgery. Medical Journal of Australia. SUBSCRIBE. Issues. Previous issue. Past issues. Guidelines. Articles. Ethics and law. Topics. Topics 1. Anaesthesia and intensive care. Biochemistry. Cardiology and cardiac surgery. Complementary medicine. Emergency medicine. Ethics. General medicine. Topics 2. General practice and primary care. Infectious diseases and parasitology. Informatics and computers. Insects, bites and stings. Law. Men s health. Military medicine. Topics 3. Orthopaedic surgery. Palliative care. Plastic surgery. Topics 4. Renal medicine. Respiratory medicine. Social issues. Sports medicine. Surgery. Vascular surgery. World health. MJA team. MJA staff. MJA instructions for authors. Cardiovascular risk perception and evidence–practice gaps in Australian general practice the AusHEART study. Should aspirin be used for the primary prevention of cardiovascular disease in people with diabetes. Should aspirin be used for the primary prevention of cardiovascular disease in ...
https://mja.com.au/journal/topics/Cardiology and cardiac surgery?page=7
*  History of Diabetes: American Diabetes Association®
... Donate Now. En Espa ol Type 1 Type 2 About Us Online Community Meal Planning. Living with Diabetes. Food Fitness. Advocacy. Research Practice. Type 2 Diabetes Risk Test. Living with Diabetes Home. Living With Type 1 Diabetes. Health Care Professionals. Food & Fitness Home Food. They notice that some people with diabetes still make their own insulin, and they identify insulin-dependent type 1 and non-insulin-dependent type 2 diabetes. The United Kingdom Prospective Diabetes Study UKPDS shows that people with type 2 diabetes who practice tight control of blood sugar levels and blood pressure levels reduce their risk of complications, similar to the results of the DCCT in people with type 1 diabetes. - 2015-oct-ryans-challenge.html Learn More Do You Know Your Risk for Type 2. - 2015-oct-health-champion.html In My Community Are You a Health Champion. Food Fitness Food Recipes Planning Meals What Can I Eat Weight Loss Fitness. In My Community ...
http://diabetes.org/research-and-practice/student-resources/history-of-diabetes.html?loc=rp-slabnav
*  SIGNS OF DIABETES | Diabetes Symptoms | Diabets mellitus in men women children
diabetic symptoms. early diabetes warning signs. Just type!... Diabetic symptoms of diabetes. Diabetic symptoms of type 1 diabetes and type 2 diabetes are critical warning signs of diabetes. Type 2 diabetes mellitus – Are you at risk from this type of diabetes. Early symptoms of diabetes - early symptoms diabetes advice Early symptoms of diabetes are the early warning signs of diabetes that all diabetics need to pay attention to as .. DIABETES symptoms of diabetes mellitus The symptoms of diabetes or the early diabetes symptoms should be identified quickly so that the onset ... Diabetes types: Types of diabetes mellitus most people don’t know about Which of the diabetes types could I be suffering from. diabetic feet Signs of Diabetes Mellitus – Diabetic Symptoms To Look For. Signs of Diabetes Mellitus: The Diabetic Symptoms of ...
http://first-signs-of-diabetes-symptoms.com/
*  Data Showing Use of Tethys Bioscience, Inc.’s PreDx(R) Diabetes Risk Score Improves Medical Manage
Data Showing Use of Tethys Bioscience, Inc.’s PreDx R Diabetes Risk Score Improves Medical Management and Outcomes in Patients at High Risk for Type 2 Diabetes Presented at International Meeting. Data Showing Use of Tethys Bioscience, Inc.’s PreDx R Diabetes Risk Score Improves Medical Management and Outcomes in Patients at High Risk for Type 2 Diabetes Presented at International Meeting April 7, 2011 Related: Bill Ericson , Randy Strahan ,. EMERYVILLE, Calif.--April 7, 2011--Data were presented today showing that utilization of the PreDx Diabetes Risk Score DRS to accurately assess a patient s risk of developing type 2 diabetes within five years results in more aggressive treatment and follow-up for diabetes prevention among patients whose test scores indicate high risk levels, as well as statistically significant improvements in their cardiometabolic risk factors, compared to patients with lower test scores and those not tested with PreDx DRS. The evidence ...
http://mdv.com/press-room/press-releases/data-showing-use-tethys-bioscience-inc’s-predxr-diabetes-risk-score-improv
*  Data Showing Use of Tethys Bioscience, Inc.’s PreDx(R) Diabetes Risk Score Improves Medical Manage
Data Showing Use of Tethys Bioscience, Inc.’s PreDx R Diabetes Risk Score Improves Medical Management and Outcomes in Patients at High Risk for Type 2 Diabetes Presented at International Meeting. Data Showing Use of Tethys Bioscience, Inc.’s PreDx R Diabetes Risk Score Improves Medical Management and Outcomes in Patients at High Risk for Type 2 Diabetes Presented at International Meeting April 7, 2011 Related: Bill Ericson, Randy Strahan,. EMERYVILLE, Calif.--April 7, 2011--Data were presented today showing that utilization of the PreDx Diabetes Risk Score DRS to accurately assess a patient s risk of developing type 2 diabetes within five years results in more aggressive treatment and follow-up for diabetes prevention among patients whose test scores indicate high risk levels, as well as statistically significant improvements in their cardiometabolic risk factors, compared to patients with lower test scores and those not tested with PreDx DRS. The evidence ...
http://mdv.com/press-room/press-releases/data-showing-use-tethys-bioscience-inc’s-predxr-diabetes-risk-score-improv
*  FPIN's Clinical Inquiries: A1C Testing in the Diagnosis of Diabetes Mellitus - American Family Physi
... cian. FPIN’s Clinical Inquiries A1C Testing in the Diagnosis of Diabetes Mellitus. Evidence-Based Answer A1C testing is highly specific compared with a two-hour oral glucose tolerance test OGTT or a fasting plasma glucose test. Evidence Summary The accuracy of A1C testing for the diagnosis of diabetes was first evaluated using pre-1997 World Health Organization WHO criteria for a diabetes diagnosis i.e., OGTT result more than 140 mg per dL fasting or more than 200 mg per dL at two hours. Based on an assumed diabetes prevalence rate of 6 percent in the general population i.e., persons without known diabetes, 63 percent of patients with an A1C level more than 6.3 percent would have diabetes positive predictive value = 63 percent. This cross-sectional study 3 of 6,559 patients that used a cutoff A1C level of 6.1 percent and assumed a diabetes prevalence rate of 6 percent showed A1C testing was 63.2 percent sensitive and 97.4 percent specific for ...
http://aafp.org/afp/2006/0701/p143.html
*  Diabetes Mellitus Type 2 In Children (Discharge Care) - Care Guide
Diabetes Mellitus Type 2 In Children Discharge Care - Care Guide. Diabetes Mellitus Type 2 In Children. Diabetes Mellitus Type 2 In Children. Diabetes mellitus type 2 is a disease that affects how your child's body uses glucose sugar. Normally, when the blood sugar level increases, the pancreas makes more insulin. Your child's blood sugar level is lower than directed and does not improve with treatment. Medicines, such as insulin or medicines by mouth, may be given to decrease the amount of sugar in your child's blood. Check your child's blood sugar level as directed:. You may need to check your child's blood sugar level at least 3 times each day. Ask your child's healthcare provider when and how often to check during the day or night. You may need to check for ketones in your child's urine or blood if his level is higher than directed. Ask your child's healthcare provider to help you create a weight loss plan for your child if he is overweight. A ...
http://drugs.com/cg/diabetes-mellitus-type-2-in-children-discharge-care.html
*  Outline of diabetes
... ' Diabetes ' group of metabolic diseases in which a person has high blood sugar, either because the pancreas does not produce enough insulin, or because cells do not respond to the insulin that is produced,. Types of diabetes Signs and symptoms of diabetes Signs and symptoms of Type II diabetes mellitus. Related conditions Preventing diabetes Preventing diabetes mellitus type 1. Preventing diabetes mellitus type 2. Treating diabetes Low-carbohydrate diet. History of diabetes Persons influential in relation to diabetes See also References External links. Diabetes mellitus type 1 disease that results in autoimmune destruction of insulin-producing beta cells of the pancreas. 2 Diabetes mellitus type 2 metabolic disorder that is characterized by high blood glucose in the context of insulin resistance and relative insulin deficiency. Signs and symptoms of diabetes. Symptoms of ...
https://en.wikipedia.org/wiki/Outline_of_diabetes
*  Diabetes Mellitus: What is the anatomy and physiology of diabetes mellitus
... Diabetes Mellitus. What is the anatomy and physiology of diabetes mellitus. what is the anatomy and physiology of diabetes mellitus. Diabetes - 1 Answers Random Answers, Critics, Comments, Opinions : 1 : Diabetes mellitus is a dysfunction of glucose metabolism. Cells in the body use the glucose produced by the food that we eat for energy. The cells get glucose via a hormone called insulin that is produced by the beta cells in the Islets of Langerhans in the pancreas. The most common analogy of this is that insulin is like a key that unlocks the cells of the body, which in turn allows glucose to enter the cells to be used for energy. Diabetes can be a lack of insulin type 1 or a resistance to insulin type 2. Type 1 diabetes requires the person to take insulin via injection or a pump. About Diabetes Mellitus "Diabetes mellitus" Ways in which diabetes mellitus can be managed Elderly primi ...
http://infoofdiabetesmellitus.blogspot.com/2009/08/what-is-anatomy-and-physiology-of.html
*  Diabetes Type 2 and Dr. Hyman's Blood Sugar Solution | FoundHealth
Diabetes Type 2 and Dr. Hyman's Blood Sugar Solution. FoundHealth. Diabetes Type 2. Diabetes Type 2 and Insulin. Diabetes Type 2 and Dr. Hyman's Blood Sugar Solution. Diabetes Type 2. Diabetes Type 2 Treatment: Diet. Diabetes Type 2 and Dr. Hyman's Blood Sugar Solution. Ask Diabetes Type 2 and Dr. Hyman's Blood Sugar Solution. Hyman's Blood Sugar Solution on Diabetes Type 2. Research Evidence on Dr. Hyman's Blood Sugar Solution. Hyman's Blood Sugar Solution. Hyman's Blood Sugar Solution for Diabetes Type 2. 0 people have tried Dr. Hyman's Blood Sugar Solution 0 people have prescribed Dr. Hyman's Blood Sugar Solution. Hyman. high blood sugar, inflammation, and other blood sugar related conditions. To treat insulin resistance, Dr. Hyman uses the term diabesity as a more comprehensive term for the continuum from optimal blood sugar balance toward insulin resistance and diabetes. Diabesity is the number 1 cause of obesity, heart ...
http://foundhealth.com/type-2-diabetes/diabetes-type-2-and-dr-hymans-blood-sugar-solution
*  Insulin therapy for type 2 diabetes - Springer
... Insulin therapy for type 2 diabetes. Share Share this content on Facebook Share this content on Twitter Share this content on LinkedIn. PubMed. CrossRef. Diabetes Care 2003, 26 :917–932. CrossRef. UK Prospective Diabetes Study UKPDS Group. CrossRef. UK Prospective Diabetes Study UKPDS Group. CrossRef. PubMed. CrossRef. Diabetes Care 2003, 26 suppl 1 :S1-S156. Ann Intern Med 2002, 136 :565–574. PubMed. PubMed. CrossRef. PubMed. CrossRef. Riddle MC: Timely addition of insulin to oral therapy for type 2 diabetes. Diabetes Care 2002, 25 :395–396. PubMed. CrossRef. Overview of 6 years therapy of type 2 diabetes: a progressive disease UKPDS 16. : Glycemic control with diet, sulfonylurea, metformin, or insulin in patients with type 2 diabetes mellitus: progressive requirement for multiple therapies UKPDS 49. : Comparison of bedtime insulin regimens in patients with type 2 diabetes mellitus. : Treatment to target study: ...
http://link.springer.com/article/10.1007/s11892-003-0081-2
*  Tethys Bioscience Inc PreDxR Diabetes Risk Score DRS Shown to Improve the Cost effectiveness of D
Tethys Bioscience Inc PreDxR Diabetes Risk Score DRS Shown to Improve the Cost effectiveness of Diabetes Prevention. PreDx R Diabetes Risk Score DRS Shown to Improve the Cost-effectiveness of Diabetes Prevention. 7/11/2011 3:01:33 PM EMERYVILLE, Calif.-- BUSINESS WIRE --Tethys Bioscience announced the publication of study results showing that the cost-effectiveness of type 2 diabetes prevention can be significantly improved when the PreDx Diabetes Risk Score DRS is used to identify patients at highest risk for diabetes. The publication reported results from a study comparing the costs and benefits of using the PreDx DRS to identify individuals at high risk of developing type 2 diabetes within a patient population that has impaired fasting glucose IFG, a well-known risk factor for diabetes. Data showed that combining the use of IFG plus the PreDx DRS improved identification among those at highest risk of developing type 2 diabetes compared ...
http://biospace.com/News/tethys-bioscience-inc-predxr-diabetes-risk-score/226584
*  Different aetiologies of Type 2 (non-insulin-dependent) diabetes mellitus in obese and non-obese sub
Different aetiologies of Type 2 non-insulin-dependent diabetes mellitus in obese and non-obese subjects - Springer. Different aetiologies of Type 2 non-insulin-dependent diabetes mellitus in obese and non-obese subjects. Affiliated with Department of Medicine, Huddinge Hospital, Karolinska Institute. Affiliated with Department of Geriatrics, Kungsgärdets Hospital, Uppsala University. Affiliated with Department of Geriatrics, Kungsgärdets Hospital, Uppsala University. Diabetic patients with abdominal obesity displayed peripheral insulin resistance in combination with defective insulin secretion, whereas non-obese diabetic patients showed only a secretory defect. Key words Insulin glucose obesity glucose disposal insulin secretion. Share Share this content on Facebook Share this content on Twitter Share this content on LinkedIn. PubMed. Gerich JE 1988 Role of insulin resistance in the pathogenesis of type 2 non-insulin-dependent diabetes mellitus. PubMed. PubMed. De ...
http://link.springer.com/article/10.1007/BF00403284
*  How To Achieve Optimal Perioperative Glycemic Control In Patients With Diabetes | Podiatry Today
How To Achieve Optimal Perioperative Glycemic Control In Patients With Diabetes. Diabetic Foot Ulcer. 18260 reads. Cook, DPM, Jeremy J. Cook, DPM, and Barry I. Rosenblum, DPM. After patients maintained well controlled blood glucose levels through an insulin infusion, researchers found that the infection rate diminished from 73 percent to 25 percent in their diabetic population. The classic prospective randomized study Diabetes Mellitus Glucose Infusion in Acute Myocardial Infarction DIGAMI showed the long-term benefit and reduction in mortality from myocardial infarction due to tight glucose control with the use of initial intravenous insulin infusion. While those with type 2 diabetes are less likely to develop ketosis, patients with type 1 diabetes may progress to ketoacidosis without insulin. This becomes important when considering the management of elevated glucose in those with type 1 and type 2 diabetes, and each type carries different consequences. The ...
http://podiatrytoday.com/article/6433?page=3
*  Book:Diabetes mellitus type 1
book diabetes mellitus type book diabetes mellitus type saved book title subtitle cover image cover color diabetes mellitus type introduction diabetes mellitus type pancreas islets of langerhans insulin blood sugar ketone symptoms and testing hla dqb polyuria polydipsia polyphagia c peptide glucose tolerance test impaired fasting glucose impaired glucose tolerance treatment and management diabetes management glucose meter insulin analog insulin therapy insulin pump inhalable insulin glycated hemoglobin pancreas transplantation islet cell transplantation complications complications of diabetes mellitus hypoglycemia diabetic neuropathy peripheral neuropathy diabetic retinopathy neuroglycopenia hyperglycemia ketosis ketonuria ketoacidosis diabetic ketoacidosis diabulimia miscellaneous history of diabetes eli lilly and company novo nordisk sanofi list of people with diabetes mellitus type
https://en.wikipedia.org/wiki/Book:Diabetes_mellitus_type_1
*  Managing Type 2 Diabetes Over Time: Lessons From the UKPDS
... Diabetes Spectrum Volume 13 Number 4, 2000, Page 194. From Research to Practice / Lessons From the UKPDS. Managing Type 2 Diabetes Over Time: Lessons From the UKPDS. Preface Matthew C. Riddle, MD. T wenty-three years ago, the Oxford University group and their collaborators started the United Kingdom Prospective Diabetes Study UKPDS, and since then they have reported its results in more than 40 publications. The UKPDS has taught us a lot. Best publicized has been the randomized comparison between a conventional treatment policy using diet alone and an intensive policy beginning with a sulfonylurea, metformin, or insulin. This part of the trial confirmed the glucose hypothesis for type 2 diabetes, 1,2 as the Diabetes Control and Complications Trial did for type 1 diabetes. Although they were designed differently, both trials showed that reducing glycosylated hemoglobin HbA 1c values by 1% reduces microvascular complications of diabetes by about 30%. In the ...
http://journal.diabetes.org/diabetesspectrum/00v13n4/page194.asp
*  Haemoglobin A1c – A Marker for Complications of Type 2 Diabetes: The Experience from the UK Prosp
... ective Diabetes Study UKPDS : Clinical Chemistry and Laboratory Medicine. Multi-Volume Works. Clinical Chemistry and Laboratory Medicine CCLM. 12 Issues per year. Issue Journal/Yearbook. Volume. Issue. Issues. Volume 53 2015. Issue 10 Sep 2015, pp. 1481-1653 Issue 9 Aug 2015, pp. Issue 8 Jul 2015, pp. 1127-1296 Issue s1 Jun 2015. Issue 7 Jun 2015, pp. 959-1125 Issue 6 May 2015, pp. 829-958 Special issue: 1st EFL... Issue 5 Apr 2015, pp. Haemoglobin A1c – A Marker for Complications of Type 2 Diabetes: The Experience from the UK Prospective Diabetes Study UKPDS. Clinical Impact of the New Criteria for the Diagnosis of Diabetes Mellitus. Haemoglobin A1c – A Marker for Complications of Type 2 Diabetes: The Experience from the UK Prospective Diabetes Study UKPDS. Volume 41, Issue 9, Pages 1182–1190, ISSN Print 1434-6621, DOI: 10.1515/CCLM.2003.182, June 2005. Interpretation of HbA1c : association with mean cell volume and haemoglobin concentration. ...
http://degruyter.com/view/j/cclm.2003.41.issue-9/cclm.2003.182/cclm.2003.182.xml
*  Diabetes control and complications trial
... The 'Diabetes Control and Complications Trial DCCT ', was a landmark medical study conducted by the United States National Institute of Diabetes and Digestive and Kidney Diseases NIDDK. 1 A study in the United Kingdom known as the United Kingdom Prospective Diabetes Study UKPDS, released in 1999, found similar results for people with type 2 diabetes. Between the two studies, the treatment of people with diabetes was significantly changed. Implications Limitations Epidemiology of Diabetes Interventions and Complications References and external links. Of those studied, 726 had no retinopathy at the beginning of the trial, and 715 had limited retinopathy. The conventional diabetes therapy group received one or two daily insulin injections. The intensive therapy group frequently monitored blood glucose levels and received at least three daily insulin injections; a few wore an external pump. Retinopathy. Among those volunteers who previously had exhibited no ...
https://en.wikipedia.org/wiki/Diabetes_control_and_complications_trial
*  .. Site Map .. You are here. .. Pages:
Types Of Diabetes. Type 1 Diabetes. Understanding Type 1 Diabetes. Basic Facts What Is Diabetes Mellitus. What Are The Symptoms Of Diabetes. Treatment Goals. What is Type 1 Diabetes. How The Body Processes Sugar Controlling Blood Sugar. The Liver Blood Sugar. Blood Sugar Other Hormones. Blood Sugar Stress. Ketones. Genetics of Type 1a. Type 1 Diabetes FAQs. Treatment Of Type 1 Diabetes. Monitoring Diabetes Goals of Treatment. Monitoring Your Blood. Diabetes Log Books. Understanding Your Average Blood Sugar. Checking for Ketones. Medications And Therapies Goals of Medication. Type 1 Insulin Therapy Insulin Basics. Types of Insulin Insulin Analogs. Intensive Insulin Therapy. Insulin Treatment Tips. Type 1 Non Insulin Therapies. Type 1 Insulin Pump Therapy What is an Insulin Pump. Pump FAQs. How To Use Your Pump. What is an Infusion Set. Ketones Insulin Pumps. Traveling Pump Therapy. Exercise Pump Therapy. Self Management Solutions. ...
http://dtc.ucsf.edu/site-map/
*  KEGG PATHWAY: Type II diabetes mellitus - Homo sapiens (human)
KEGG PATHWAY: Type II diabetes mellitus - Homo sapiens human. Type II diabetes mellitus - Homo sapiens human. [ Pathway menu Organism menu Pathway entry. Download KGML Show description User data mapping ]. Insulin resistance is strongly associated with type II diabetes. "Diabetogenic" factors including FFA, TNFalpha and cellular stress induce insulin resistance through inhibition of IRS1 functions. Serine/threonine phosphorylation, interaction with SOCS, regulation of the expression, modification of the cellular localization, and degradation represent the molecular mechanisms stimulated by them. Various kinases ERK, JNK, IKKbeta, PKCzeta, PKCtheta and mTOR are involved in this process. The development of type II diabetes requires impaired beta-cell function. Chronic hyperglycemia has been shown to induce multiple defects in beta-cells. Hyperglycemia has been proposed to lead to large amounts of reactive oxygen species ROS in beta-cells, with subsequent damage to ...
http://kegg.jp/kegg-bin/show_pathway?hsa04930 3767
*  Search of: Open Studies | "Diabetes Mellitus, Type 2" - List Results - ClinicalTrials.gov
Search of: Open Studies. Diabetes Mellitus, Type 2 - List Results - ClinicalTrials.gov. Terms and Conditions. Diabetes Mellitus, Type 2 Modify this search. Diabetes Mellitus, Type 2 Need help. Download Download the search results for: Open Studies. Diabetes Mellitus, Type 2 1079 records Need help. Download Content: Download All Study Fields as XML Download All Study and Results Fields as XML Download Selected Fields:. Condition. Study Type. Conditions: Diabetes Mellitus, Type 2; Diabetes Complications; Diabetic Angiopathies; Diabetic Nephropathies. 3 Recruiting Safety and Efficacy of Vildagliptin Plus Metformin SPC Treatment in Type 2 Diabetes Mellitus Patients. 4 Recruiting Simvastatin and Fenofibrate vs Simvastatin Alone in Patients With Type 2 Diabetes Mellitus and Acute Coronary Syndrome. Conditions: Acute Coronary Syndrome; Diabetes Mellitus, Type 2; Hypertriglyceridemia. 5 Recruiting ...
https://clinicaltrials.gov/ct2/results?recr=Open&cond="Diabetes Mellitus, Type 2"&show_rss=Y&sel_rss=mod14
*  Diabetes prevention studies
... published on international diabetes federation http www idf org home diabetes prevention studies diabetes prevention studies there is overwhelming evidence from studies in the usa finland china india and japan that lifestyle changes achieving a healthy body weight and moderate physical activity can help prevent the development of type diabetes in those at high risk the new idf strategy advocates that this should be the initial intervention for all people at risk of developing type diabetes as well as the focus of population health approaches there is growing evidence that earlier detection of individuals with igt impaired glucose tolerance and others at high risk of developing diabetes followed by interventions to delay or prevent type diabetes and improve glucose control can result in clinically important reductions in the incidence of diabetes and its complications and co morbidities malmö study da qing study diabetes prevention study ...
http://idf.org/print/diabetes-prevention/prevention-studies?language=ar
*  Diabetes prevention studies
... published on international diabetes federation https www idf org home diabetes prevention studies diabetes prevention studies there is overwhelming evidence from studies in the usa finland china india and japan that lifestyle changes achieving a healthy body weight and moderate physical activity can help prevent the development of type diabetes in those at high risk the new idf strategy advocates that this should be the initial intervention for all people at risk of developing type diabetes as well as the focus of population health approaches there is growing evidence that earlier detection of individuals with igt impaired glucose tolerance and others at high risk of developing diabetes followed by interventions to delay or prevent type diabetes and improve glucose control can result in clinically important reductions in the incidence of diabetes and its complications and co morbidities malmö study da qing study diabetes prevention study ...
https://idf.org/print/diabetes-prevention/prevention-studies
*  Medium-term Health Coaching and Life-long Monitoring in Diabetes Mellitus - Full Text View - Clinica
... lTrials.gov. Learn About Clinical Studies. ClinicalTrials.gov Background. Find Studies Study Record Detail. Medium-term Health Coaching and Life-long Monitoring in Diabetes Mellitus RenewingHealth This study has been completed. ClinicalTrials.gov Identifier: NCT01580098 First received: April 17, 2012 Last updated: August 21, 2015 Last verified: April 2015 History of Changes. Study Results. Evaluation whether the introduction of large-scale personalized and technology supported telemonitoring and health coaching interventions produces benefits in terms of health related quality of life, health status and empowerment of patients with type 2 diabetes mellitus. Diabetes Mellitus Type 2. Other: Self-monitoring for patients with Diabetes mellitus type 2 Other: Nurse-monitoring for patients with Diabetes mellitus type 2. Further study details as provided by Landeskrankenanstalten-Betriebsgesellschaft:. Primary Outcome Measures: Health Related ...
https://clinicaltrials.gov/ct2/show/NCT01580098
*  .. 3 1/2 day insulin workshop .. The 3½-day class is for people with insulin-treated diabetes. .
2 day type 2 workshop » « Workshops And Classes. The workshop meets for ½ day on Monday and all day the following Tuesday, Wednesday and Thursday. The workshop meets for ½ day on Monday and all day the following Tuesday, Wednesday and Thursday. Understand diabetes: its types, its causes and effects, and the goals of treatment Effective ways of managing lifestyle changes: exercise, diet, meal planning, weight management and prevention of low blood sugar How to manage insulin: principles of usage, modes of action, the best regimen, dose adjustments How to test blood sugar and ketones and develop skills for adjusting therapy How to prevent and manage potential complications, both acute and chronic How to recognize the psychosocial issues: emotional adjustment to diabetes mellitus, the role of family and support groups Program outline. Each day will allow for individual time to discuss diabetes care regimen with educators. Diabetes-focused consultation and physical exam with ...
http://dtc.ucsf.edu/workshops-and-classes/3-12-day-insulin-workshop/
*  Projecting the Future Diabetes Population Size and Related Costs for the U.S.
Abstract. The forecasting effort presented in this article speaks directly to this concern by improving the rigor of the estimates of health outcomes and health care spending associated with future trends in the incidence, prevalence, and progression toward complications. We set out to integrate recent prediction models and epidemiological data for obesity, diabetes incidence, and diabetes complications to forecast the future size of the diabetic population and their related health care costs. The prevalent cohort is the population of individuals with diabetes in 2008. The number of people with diabetes in any year is the sum of the population in the previous year in 2008, it is the prevalent cohort and the incident cohort, minus deaths from all causes in the previous year's population with diabetes. The results of our model regarding overall population changes in obesity, future population size, and health care spending have been briefly described in a related publication ...
http://care.diabetesjournals.org/content/32/12/2225.long
*  Prevention of diabetes mellitus type 2
... 'Prevention of diabetes mellitus type 2' can be achieved with both lifestyle changes and medication use; onset of type 2 diabetes can often be delayed through proper nutrition and regular exercise. 1 The National Institute of Diabetes and Digestive and Kidney Diseases has spent over $1 billon dollars on diabetes prevention efforts each year. "Diabetes research: a perspective from the National Institute of Diabetes and Digestive and Kidney Diseases." Diabetes, Feb. Increasing physical activity may be helpful in preventing type 2 diabetes, particularly if undertaken soon after a carbohydrate rich meal that increases blood sugar levels. The American Diabetes Association ADA recommends maintaining a healthy weight, getting at least 2½ hours of exercise per week several brisk sustained walks appear sufficient, having a modest fat intake around 30% of energy supply should come from fat, and eating sufficient fiber e.g., from whole grains. ...
https://en.wikipedia.org/wiki/Prevention_of_diabetes_mellitus_type_2
*  Diabetes mellitus type 1
... Name = Diabetes type 1. }} 'Diabetes mellitus type 1' also known as 'type 1 diabetes', or 'T1D'; formerly 'insulin-dependent diabetes' or 'juvenile diabetes' is a form of diabetes mellitus that results from the autoimmune destruction of the insulin -producing beta cells in the pancreas. Diabetes mellitus type 1 accounts for between 5% and 10% of all diabetes cases. Insulin. Many type 1 diabetics are diagnosed when they present with diabetic ketoacidosis. The pathophysiology in diabetes type 1 is a destruction of beta cell s in the pancreas, regardless of which risk factors or causative entities have been present. The time interval from emergence of autoantibodies to clinically diagnosable diabetes can be a few months in infants and young children, but in some people it may take years – in some cases more than 10 years. There are four main types of insulin, rapid acting insulin, short acting insulin, intermediate ...
https://en.wikipedia.org/wiki/Diabetes_mellitus_type_1
*  Home Blood Pressure Monitoring and Diabetes
... Clinical Diabetes Skip to main page content Home. Current Issue. Archive. Contact Us. Subscribe. Help. Alerts. Podcasts. Search. GO Advanced Search ». User Name. Password. Sign In. . Home Blood Pressure Monitoring and Diabetes John R. White, Jr., PharmD, PA-C and. Jason Schick, PharmD. Home blood pressure monitoring HBPM may be useful in the management of many patients with hypertension and diabetes. Blood pressure monitoring traditionally has been carried out in providers’ offices. However, many patients visit their providers only once or twice a year, which limits their ability to monitor hypertension. Over the past several years, HBPM technology has evolved to a point where accuracy and ease of use now make this form of monitoring feasible and useful in many cases. This evolution has been similar in some ways to that of blood glucose meters. When relatively accurate and easy to use blood glucose monitors were first produced, their role was a subject of debate. Today, they are ...
http://clinical.diabetesjournals.org/content/22/1/28.full
*  Blood pressure by 24 h ambulatory recordings in type 2 (non-insulin dependent) diabetics. Relationsh
Blood pressure by 24 h ambulatory recordings in type 2 non-insulin dependent diabetics. Relationship to urinary albumin excretion. BioMedSearch. Home. Advanced Search. Tools. Search Tutorial. Login. Create Free Account. Document Detail. Blood pressure by 24 h ambulatory recordings in type 2 non-insulin dependent diabetics. Relationship to urinary albumin excretion. MedLine Citation:. PMID: 1864438 Owner: NLM Status: MEDLINE. Abstract/OtherAbstract:. The relationship between blood pressure and microalbuminuria, both associated with cardiovascular disease and death, is sparsely studied in Type 2 non-insulin-dependent diabetes, and results may be interfered by the phenomenon of "white-coat-hypertension". We therefore investigated blood pressure by 24h ambulatory recordings oscillometry and examined whether blood pressure related to the level of urinary albumin excretion rate UAER by synchronous 24h collections. Seventeen diabetics 50-75 years of age with microalbuminuria 15 less than UAER less than 200 ...
http://biomedsearch.com/nih/Blood-pressure-by-24-h/1864438.html
*  Indmedica - Biomedical Research
Data regarding bone related parameters like calcium, phosphorus, hydroxyproline, bone formation marker alkaline phosphatase, HbA1c and blood sugar levels were estimated. The results obtained showed that in postmenopausal diabetic women the serum alkaline phosphatase tends to be higher, while serum calcium and phosphorus levels are decreased, moreover an increase in level of urinary calcium and hydroxyproline is seen. Clinical Material Subjects: The clinical material for the present study comprised of a total of 78 post menopausal subjects. Data regarding history of diabetes, HbA1c values, random blood glucose RBG levels, bone-related parameters like calcium phosphorus, alkaline phosphatase ALP and hydroxyproline was obtained by structured questionnaires and by clinical and laboratory assessments. Clinical Method: estimation of HbA1c, Blood sugar and bone related biochemical parameters HbA1c, Calcium, Phosphorus, Alkaline phosphatase and Random blood sugar are estimated on fully automated auto-analyzer ...
http://indmedica.com/journals.php?journalid=12&issueid=116&articleid=1560&action=article
*  The Caring for Diabetes Educational ForumDiabetes Educational Resources :: Caring for Diabetes Educa
The Caring for Diabetes Educational Forum. Diabetes Educational Resources :: Caring for Diabetes Educational Forum. documentation-naive. documentation-naive. Search:. Home. Register or Login. Contact Us. ****JavaScript based drop down DHTML menu generated by NavStudio. OpenCube Inc. - http://www.opencube.com ****. Educational Resources Home. DMC Education Center. Literature Library. Slide Library. Multimedia Library. Diagnostic Tools and Techniques. Conference Reports. Utilisation of antihyperglycaemic drugs in ten European countries: different developments and different levels. Melander A, Folino-Gallo P, Walley T, et al. Diabetologia. 2006;49:2024-2029. Antihyperglycemic drugs AHGDs include insulin and oral agents, such as sulfonylureas and metformin, that are used to improve blood glucose levels. The United Kingdom Prospective Diabetes Study UKPDS demonstrated that tight glycemic control, achieved through use of AHGDs, was more effective than lifestyle management alone in ...
http://caringfordiabetes.com/Educational-Resources/LiteratureLibrary/melander.cfm
*  PPT – DIABETES MELLITUS Type 1 PowerPoint presentation | free to download - id: 27511a-MzAzM
PPT DIABETES MELLITUS Type 1 PowerPoint presentation. Presentations free-to-view. DIABETES MELLITUS Type 1 - PowerPoint PPT Presentation. And it’s free to register and free to log in. PPT DIABETES MELLITUS Type 1 PowerPoint presentation. PowerPoint PPT presentation. 12 Medical Treatment continued A student with Type I Diabetes may wear an insulin pump A student will still require to test their blood glucose during the school day They will need to make adjustments on their insulin pump Lewis, K., and Bear, B., 2009. 13 INSULIN PUMP 14 Reactions while in school Two reactions a student may have while in school related to using insulin HYPERGLYCEMIA- blood glucose too high HYPOGLYCEMIA- blood glucose too low Lewis, K., and Bear, B., 2009. You can use PowerShow.com to find and download example online PowerPoint ppt presentations on just about any topic you can imagine so you can learn how to improve your own slides and presentations for free. Or use it to find and ...
http://powershow.com/view/27511a-MzAzM/DIABETES_MELLITUS_Type_1_powerpoint_ppt_presentation
*  Study of RO6807952 in Patients With Diabetes Mellitus Type 2 - Full Text View - ClinicalTrials.gov
... ClinicalTrials.gov Background. Study of RO6807952 in Patients With Diabetes Mellitus Type 2 This study has been terminated. Sponsor: Hoffmann-La Roche Information provided by Responsible Party : Hoffmann-La Roche. ClinicalTrials.gov Identifier: NCT01516476 First received: January 12, 2012 Last updated: October 1, 2015 Last verified: October 2015 History of Changes. This randomized, double-blind, placebo-controlled, multi-center study will evaluate the efficacy and safety of RO6807952 in patients with diabetes mellitus type 2 inadequately controlled with metformin alone. Patients will be randomized to receive doses of RO6807952, placebo, or liraglutide. Diabetes Mellitus, Type 2. Drug: Placebo Drug: RO6807952 Drug: liraglutide. Official Title: A Multi-Center, Double-Blind, Randomized, Placebo-Controlled, Parallel-Group Study to Assess the Efficacy and Safety of RO6807952 in Type 2 Diabetic Patients Inadequately Controlled With Metformin Alone. Further study ...
https://clinicaltrials.gov/ct2/show/NCT01516476?term="Type 2 Diabetes"&lup_s=07/05/2014&lup_d=14&show_rss=Y&sel_rss=mod14
*  Genetic causes of diabetes mellitus type 1
genetic causes of diabetes mellitus type genetic causes of diabetes mellitus type at least different chromosomal regions have been linked to type diabetes t d susceptibility in humans using genome screening candidate gene testing and studies of human homologues of mouse susceptibility genes responsible genes the largest contribution to the pathogenesis of type diabetes comes from a single locus called iddm comes from several genes located in the major histocompatibility complex on the p chromosome this is believed to be responsible for at least of the disease s familial aggreagation additionally nearly of type i diabetes patients are heterozygous for several hla dq specifically hla dq dq alleles however the hla dq allele hla dqa dqb if dominant is responsible for partially preventing an organism from developing the disease therefore these genetic features can be used to determine a patient s relative risk of developing the disease further discussion and ...
https://en.wikipedia.org/wiki/Genetic_causes_of_diabetes_mellitus_type_1
*  Lifestyle causes of diabetes mellitus type 2
... A number of lifestyle factors are known to be important to the development of diabetes mellitus type 2 including: obesity, physical activity, diet, stress, and urbanization. 2 A number of dietary factors such as sugar sweetened drinks. 5 In one study, those who had high levels of physical activity, a healthy diet, did not smoke, and consumed alcohol in moderation had an 82% lower rate of diabetes. In this study, a healthy diet was defined as one high in fiber, with a high polyunsaturated to saturated fat ratio, lower trans fats consumption, and a lower mean glycemic index. 6 Dietary Obesity Sleep Prenatal environment Other References. The composition of dietary fat intake is linked to diabetes risk; decreasing consumption of saturated fats and trans fatty acids while replacing them with unsaturated fats may decrease the risk. 7 Sugar sweetened drinks appear to increase the risk of type 2 diabetes both through their role in obesity and potentially through a direct ...
https://en.wikipedia.org/wiki/Lifestyle_causes_of_diabetes_mellitus_type_2
*  CDC - National Diabetes Prevention Program - Diabetes DDT
... Skip directly to search Skip directly to A to Z list Skip directly to site content Skip directly to page options. CDC Home CDC 24/7: Saving Lives. Protecting People. Search The CDC. Note: Javascript is disabled or is not supported by your browser. For this reason, some items on this page will be unavailable. For more information about this message, please visit this page: About CDC.gov. National Diabetes Prevention Program. Prevent Diabetes STAT: Get Involved. Program Video: Watch and download a video about the program. Find A Program: Find a lifestyle change program near you. National CDC/AMA Call to Action. For Healthcare Providers. Diabetes Prevention Recognition Program. Program Topics About the Program Learn about the National Diabetes Prevention Program. Prediabetes: Am I at Risk. Learn about prediabetes and download the prediabetes screening test. CDC National DPP Curriculum The CDC National DPP curriculum is for lifestyle coaches and organizations ...
http://cdc.gov/diabetes/prevention/
*  Questions About Diabetes Complications
... NetWellness is a global, community service providing quality, unbiased health information from our partner university faculty. NetWellness is commercial-free and does not accept advertising. Tuesday, October 6, 2015. Home HealthTopics Health Centers Reference Library Research. Join us on Facebook Share on Facebook. Tweet. Share. Search. Advanced. Diabetes. Questions About Diabetes Complications. Can Diabetes Cause Blurred Vision. Can Receiving Vaccinations Cause Complications in Someone with Type-2 Diabetes. How Are Cholesterol, Triglyceride, Weight, and High Blood Pressure Related to Diabetes. How Are Depression and Diabetes Linked. How is it Treated in People with Diabetes. How Can Diabetes Affect Cardiovascular Health. How Can Diabetes Affect my Mood. How Can Diabetes Affect my Sexual Response. How Can Diabetes Affect Nerve Endings. How Can Diabetes Affect Oral Health. How Can Diabetes Affect the Digestion. How ...
http://netwellness.org/healthtopics/diabetes/diabetesquestion12.cfm
*  Questions About Diabetes Complications
... NetWellness is a global, community service providing quality, unbiased health information from our partner university faculty. NetWellness is commercial-free and does not accept advertising. Wednesday, October 7, 2015. Home HealthTopics Health Centers Reference Library Research. Join us on Facebook Share on Facebook. Tweet. Share. Search. Advanced. Diabetes. Questions About Diabetes Complications. Can Diabetes Cause Blurred Vision. Can Receiving Vaccinations Cause Complications in Someone with Type-2 Diabetes. How Are Cholesterol, Triglyceride, Weight, and High Blood Pressure Related to Diabetes. How Are Depression and Diabetes Linked. How is it Treated in People with Diabetes. How Can Diabetes Affect Cardiovascular Health. How Can Diabetes Affect my Mood. How Can Diabetes Affect my Sexual Response. How Can Diabetes Affect Nerve Endings. How Can Diabetes Affect Oral Health. How Can Diabetes Affect the Digestion. ...
http://netwellness.uc.edu/healthtopics/diabetes/diabetesquestion12.cfm
*  Diabetes mellitus type 1 in adults
 Diabetes mellitus type 1 in adults. Skip to main content. About Us. Careers. For Medical Professionals. Give / Volunteer. En Español. Employee Sign In. Navigation Locations. Doctors Providers. Health, Conditions Treatments. Medical Services. Customer Service. Family Health Manager. MyChart. Home > Health, Conditions and Treatments > Health library. Health Guide Health Encyclopedia. Lab Tests. Drug Guide DrugNotes. Spanish DrugNotes. Detailed Drug Information. Alternative Medicine. Diabetes mellitus type 1 in adults What is it. Diabetes di-ah-BE-tez is also called diabetes mellitus MEL-i-tus. There are three main types of diabetes. You have type 1 diabetes. Type 1 diabetes happens when your pancreas an organ that lies behind the stomach does not make insulin. It may also be called insulin dependent, early onset, or juvenile onset diabetes. Type 1 diabetes is more common in children or young adults but anyone can have it. ...
http://allinahealth.org/CCS/doc/Alternative_Medicine/48/20156.htm
*  Poems & Tips From Other Journals - American Family Physician
AAFP members and paid subscribers: Log in to get free access. All others: Purchase online access. Clinical Question: Does tight blood pressure control improve visual outcomes in patients with diabetes and hypertension. Setting: Outpatient any Study Design: Randomized controlled trial double-blinded Allocation: Concealed Synopsis: In this substudy of the landmark United Kingdom Prospective Diabetes Study, 1,148 patients with hypertension and diabetes were assigned randomly in a 2:1 ratio to tight or loose control of blood pressure, with target blood pressures of 150/85 mm Hg or 200/105 mm Hg, respectively. The loose control target pressure was changed to 185/105 mm Hg midway through the study. The average blood pressure in the tight control group was 144/82 mm Hg, and in the loose control group, it was 154/87 mm Hg. The mean glycohemoglobins were similar in these groups: 7.2 percent during the first four years of the study, and 8.2 to 8.3 percent for the final four years. The tight ...
http://aafp.org/afp/2005/0315/p1186.html
*  Diabetes and Heart Disease - The University of Chicago Medicine
... Diabetes and Heart Disease The link between diabetes and heart disease Heart and vascular disease often go hand in hand with diabetes. People with diabetes are at a much greater risk for heart attacks, strokes, and high blood pressure. Silent heart disease in young people with diabetes Serious cardiovascular disease can begin before the age of 30 in people with diabetes. Type 2 diabetes also called non-insulin dependent diabetes mellitus is the result of the body's inability to make enough, or to properly use, insulin. Many studies demonstrate that people with type 2 diabetes are at increased risk for heart disease. In fact, one study found that people with type 2 diabetes without apparent heart problems ran the same risk for heart disease as people without diabetes who had already suffered one heart attack. What causes heart disease in people with diabetes. People with diabetes often experience changes in ...
http://uchospitals.edu/online-library/content=P00341
*  DME - Overview: Diabetes Mellitus Type 1 Evaluation
... Search Mayo Medical Laboratories Search. MayoACCESS. Test Catalog Go Test Name A. Test Catalog Test Information New Tests Test Updates Reflex Tests Referred Tests NYS Informed Consent Test List Download Catalog References Critical Values and Semi-Urgent Results Performing Locations Policies. Setup Information Test Setup AOE Codes LOINC Codes Units of Measurement. New Tests. Setup Information. Critical Values and Semi-Urgent Results. Referred Tests. NYS Informed Consent Test List. Test Ordering MayoACCESS Overview References MayoLINK Overview References. Specimen Handling Collection and Preparation Instructions by Specimen Type Category A Infectious Substances Light Protection Tests Microbiology Culture Tests Resources Supply Catalog FAQ Dangerous Goods Training. Specimen Transport Customized Shipping Instructions Shipping Guides Courier Instructions Transportation Regulations CDC Permit. Outreach Resources Outreach Areas Outreach Education Support Services Operations Sales and Marketing Billing and ...
http://mayomedicallaboratories.com/test-catalog/Overview/60480
*  Tip 2 diabetes mellitus - Vikipedi
... Tip 2 diabetes mellitus Vikipedi, özgür ansiklopedi. Tip 2 diabetes mellitus. Universal blue circle symbol for diabetes. Tip 2 diabetes mellitus önceki adıyla insüline bağımlı olmayan diyabet NIDDM veya erişkin dönemde ortaya çıkan diyabet –, insülin direnci ve buna bağlı insülin eksikliği bağlamında yüksek kan şekeri ile karakterize edilen bir metabolik bozukluktur. Uyku eksikliği de tip 2 diyabetle ilişkilendirilmiştir. "White rice consumption and risk of type 2 diabetes: meta-analysis and systematic review". Type 2 diabetes mellitus : an evidence-based approach to practical management. "Definition, diagnosis and classification of diabetes mellitus and its complications: Report of a WHO Consultation. "International Expert Committee report on the role of the A1C assay in the diagnosis of diabetes". "Fruit and vegetable intake and incidence of type 2 diabetes mellitus: systematic review and ...
https://tr.wikipedia.org/wiki/Tip_2_diabetes_mellitus
*  D8S1950 Marker Search Result - Rat Genome Database
... Citing RGD. Contact Us. Search RGD Grant Resources Citing RGD About Us Contact Us. Genes. QTLs. Rat GBrowse. Cancer. Position Map Chr Position Strand Source RGSC Genome Assembly v6.0 5 27,439,025 - 27,439,130. NCBI. UniSTS. RGSC Genome Assembly v5.0 5 32,130,177 - 32,130,282. UniSTS. RGSC Genome Assembly v3.4 5 28,337,448 - 28,337,553. UniSTS. Rat Celera Assembly 5 26,606,949 - 26,607,054. UniSTS. Is Marker For: Genes: Runx1t1. Launch Genome Browser GBrowse for Chr5:32130177..32130282 Launch JBrowse. Region. Genes in Region RGSC Genome Assembly v5.0. The following Genes overlap with this region. RGD ID Symbol Name Chr Start Stop Species. 1305490 Runx1t1 runt-related transcription factor 1; translocated to, 1 cyclin D-related 5 31976957 32132101 Rat. Nucleotide Sequences Nucleotide RefSeqs NM_001108657 Get FASTA Search GEO for Microarray Profiles. GenBank Nucleotide G07179 Get FASTA Search GEO for Microarray Profiles. X79990 Get FASTA Search GEO for Microarray Profiles. QTLs in Region RGSC Genome ...
http://rgd.mcw.edu/rgdweb/report/marker/main.html?id=5027725
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Diabetes Facts. I Have Diabetes. Am I at Risk. About NDEP. You are here: NDEP Home. Resources. Diabetes HealthSense. Resource Name A-Z Resource Name Z-A No Cost No Registration No Cost or Registration. Centers for Disease Control CDC. Exercise & Physical Activity: Your Everyday Guide. This guide shows you many types of exercise and physical activity. Guide to a Healthy Heart for Latinos. This national weight management program is designed to help veterans lose weight, keep it off, and improve their health. En español U.S. En español American Diabetes Association ADA. En español National Diabetes Education Program NDEP. En español American Diabetes Association ADA. En español Centers for Disease Control and Prevention CDC. From the American Diabetes ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=2,31,44&sort=0&page=-1
*  KEGG PATHWAY: Maturity onset diabetes of the young - Homo sapiens (human)
KEGG PATHWAY: Maturity onset diabetes of the young - Homo sapiens human. Maturity onset diabetes of the young - Homo sapiens human. [ Pathway menu Organism menu Pathway entry. Download KGML Show description User data mapping ]. About 2-5% of type II diabetic patients suffer from a monogenic disease with autosomal dominant inheritance. This monogenic form of type II diabetes is called maturity onset diabetes of the young MODY. We now know that MODY is caused by heterozygous mutations in at least five genes encoding transcription factors: HNF4alpha MODY1, HNF1alpha MODY3, PDX1 MODY4, HNF1beta MODY5 and NEUROD1 MODY6. MODY2, which is so far the only subtype not related to a transcription factor, is caused by mutations in the glucokinase gene. Mutations of MODY transcription factor genes lead to abnormal expression of genes involved in pancreatic islet development and metabolism.
http://kegg.jp/kegg-bin/show_pathway?hsa04950 5080
*  Reviewing the effects of hyperglycemia and diabetes mellitus on COPD | ConsultantLive
Reviewing the effects of hyperglycemia and diabetes mellitus on COPD. ConsultantLive. Skip to main content. Search For... Search. ConsultantLive SearchMedica. Topics: Atrial Fibrillation. Cardiovascular Diseases. COPD. Men s Health. Diabetes Type 2. Pain. HIV AIDS. Nervous System Diseases. Obesity. Respiratory Diseases. Browse All Topics All Topics Atrial Fibrillation Cardiovascular Diseases COPD Men's Health Diabetes Type 2 Pain HIV AIDS Nervous System Diseases Obesity Respiratory Diseases. MAIN MENU Home Topics Dermatology Cardiovascular Diabetes GI HIV/AIDS Conferences Quizzes Photoclinic Image IQ Pediatrics. Welcome Guest. Login or Register Welcome My Account. My Account or Logout. Connect to other sites within the UBM Medica Network. Search For... Search. ConsultantLive SearchMedica. Topics: Atrial Fibrillation. Cardiovascular Diseases. COPD. Men s Health. Diabetes Type 2. Pain. HIV AIDS. Nervous System Diseases. Obesity. Respiratory Diseases. Browse All Topics ...
http://consultantlive.com/articles/reviewing-effects-hyperglycemia-and-diabetes-mellitus-copd
*  DoctorYourself.com - Diabetes
Diabetes. Diabetes Home. The negative factors are diets which are too rich in free sugars and not rich enough in the complex carbohydrates. I have also found niacin very helpful in preventing patients from suffering the long term ravages of diabetes, which are not directly due to high blood sugars, but to the side effects involving the vascular system. Type II Non-insulin dependent Diabetes Mellitus NIDDM was formerly known as hyperinsulinism or hypoglycemia. Positive factors listed are magnesium, exercise, weight control, chromium, fiber, vitamin E, vanadium, vitamin C, and complex carbohydrates. One of the first nutrition zingers I ever read was Dr Carlton Fredericks comment in Food Facts and Fallacies to the effect that diabetics could be weaned off of insulin with extremely high doses of B-complex vitamins. More on this subject will be found in Childhood immunization and diabetes mellitus, New Zealand Medical Journal , May 1996. Effects of oral magnesium ...
http://doctoryourself.com/diabetes.html
*  Northside Hospital - Diabetes educationNorthside Hospital -
Northside Hospital - Diabetes education. Northside Hospital -. Medical Services. Classes Events. Maternity Classes. • Diabetes - low blood sugar ... Diabetes education Information Diabetes self-management education is an important part of a treatment plan. There are three levels of diabetes education: Basic disease management, including basic "survival skills" Home management Lifestyle improvement Basic diabetes management includes the knowledge and skills that a person who is newly diagnosed with diabetes must master before leaving the hospital or health care provider's office. These skills include: Learning how to recognize and treat low blood sugar hypoglycemia Learning how to recognize and treat high blood sugar hyperglycemia Learning how to select the right foods and when to eat them diabetes diet Learning how to give yourself insulin or take oral hypoglycemic medications Learning how to test and record blood glucose see: blood glucose monitoring ...
http://northside.com/HealthLibrary/?Path=HIE Multimedia\1\003996.htm
*  Exercise or exercise and diet for preventing type 2 diabetes mellitus | Cochrane
Exercise or exercise and diet for preventing type 2 diabetes mellitus. Exercise or exercise and diet for preventing type 2 diabetes mellitus Type 2 diabetes is mainly characterised by a reduced ability of the hormone insulin to stimulate glucose uptake in body fat and muscles insulin resistance combined with insufficient insulin secretion that leads to increased blood glucose levels. We assessed the effects of increased physical activity alone or in combination with dietary interventions on diabetes incidence and other outcomes. We included eight trials with 2241 participants randomised to exercise and diet intervention and 2509 participants to standard recommendation. Incidence of diabetes was reduced by 37% relative risk reduction with exercise and diet. No study reported relevant data on diabetes and cardiovascular related morbidity, all-cause mortality and quality of life. Authors conclusions: Interventions aimed at increasing exercise combined with ...
http://cochrane.org/CD003054/ENDOC_exercise-or-exercise-and-diet-for-preventing-type-2-diabetes-mellitus
*  Dr Whitaker - Search Results for Type-2-Diabetes
... Whitaker's Blog. Type-2-Diabetes. Type-2-Diabetes. Type 2 Diabetes Symptoms Many people dealing with diabetes admit that the disease snuck up on them. Type 2 diabetes, sometimes referred to as non-insulin-dependent diabetes or adult-onset diabetes, is marked by elevated blood glucose levels. For starters, all of the type 2 Read More Related Searches: Mini Fast Diet. Berberine Reversing Type 2 Diabetes: Baked Salmon Dijon Omega-3 fatty acids are essential for good health and salmon is one of the best sources of these healthy fats, especially in you re interested in reversing type 2 diabetes. According to researchers, a review of 10,000 smokers found that the risk of type 2 diabetes actually went up when people quit Read More. Type 2 Diabetes Is No Longer an Adult Disease Type 2 diabetes, sometimes referred to as adult-onset diabetes, was once considered an adult-only condition. The study funded by Diabetes ...
http://drwhitaker.com/search/go?p=Q&lbc=drwhitaker&sli_id=685561315&ts=custom&w=Type-2-Diabetes&isort=score&method=and&view=list&modaf=daf:1 a:type:socialmedia
*  EPICC Program
Health Conditions. Diabetes. Lifestyle Change Programs. Diabetes Prevention Program. Diabetes Self-Management Education. Living Well Self-Management Programs. Resources Locator. Tools and Resources. Lifestyle Change Programs. Health Programs. Tools and Resources. Utah Data. Diabetes Prevention Program. National Diabetes Prevention Program. The Centers for Disease Control and Prevention's CDC National Diabetes Prevention Program National DPP is an evidence-based lifestyle change program for preventing type 2 diabetes. It can help people cut their risk of developing type 2 diabetes in half. These lifestyle changes reduced the risk of developing type 2 diabetes by 58% in people with prediabetes. For more information about the National Diabetes Prevention Program curriculum, go to www.cdc.gov/diabetes/prevention or watch the CDC's Diabetes Prevention Program video online, or download and print the National DPP Infographic ...
http://choosehealth.utah.gov/your-health/lifestyle-change/diabetes-prevention-program.php
*  Setting Sights on Diabetes - The Center for Global Health and Diplomacy
... Challenges Global Health Challenges. Diabetes. Diabetes is emerging as a global public health crisis. This microvascular injury leads to the major complications of diabetes including damage to the eyes leading to visual impairment, kidneys leading to renal failure, nerves leading to progressive loss of peripheral sensation, large blood vessels leading to myocardial infarction and stroke and impaired wound healing increasing infection rates. In the United States it has been estimated that the per capita annual medical care costs are $13,243 for diabetic patients and $2,560 for non-diabetic patients. FIGURE 1 The blood vessels of the retina are frequently damaged in diabetic patients. Studies such as the Diabetes Complications and Control Trial DCCT , UK Prospective Diabetes Study UKPDS and the Action to Control Cardiovascular Risk in Diabetes ACCORD study have all demonstrated that intensive control of blood sugar, as measure by the hemoglobin A1C, reduces the ...
http://ghdnews.com/index.php/global-health-challenges/non-communicable-diseases-ncds/diabetes/29-setting-sights-on-diabetes
*  Tethys Bioscience and ACAP Health Consulting Partner to Help Employers Prevent Diabetes | Mohr David
Tethys Bioscience and ACAP Health Consulting Partner to Help Employers Prevent Diabetes. Mohr Davidow Ventures. Tethys Bioscience and ACAP Health Consulting Partner to Help Employers Prevent Diabetes December 7, 2011 Related: Bill Ericson,. 7, 2011 -- Tethys Bioscience has entered into an agreement with ACAP Health Consulting, an industry leader in helping employers measurably flatten the trajectory of their healthcare trends through reducing the production and destruction of disease in their employee populations. The agreement allows ACAP Health to offer the PreDx Diabetes Risk Score DRS to employers as a component of its disease intervention programs. The PreDx DRS is a multi-biomarker blood test that identifies the individuals at highest risk for developing type 2 diabetes within 5 years. In addition to enabling the more cost-efficient allocation of healthcare resources toward those at highest risk of progressing to diabetes, PreDx DRS has been shown to be an effective ...
http://mdv.com/press-room/press-releases/tethys-bioscience-and-acap-health-consulting-partner-help-employers-preven
*  Diabetes Mellitus
SOURCE: National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, U.S. Hypoglycemia— A condition where there is too little glucose or sugar in the blood. This form also is called insulin-dependent diabetes because people who develop this type need to have daily injections of insulin. Brittle diabetics are a subgroup of Type I where patients have frequent and rapid swings of blood sugar levels between hyperglycemia a condition where there is too much glucose or sugar in the blood and hypoglycemia a condition where there are abnormally low levels of glucose or sugar in the blood. Many people with Type II diabetes can control the condition with diet and oral medications, however, insulin injections are sometimes necessary if treatment with diet and oral medication is not working. Individuals who are at high risk of developing Type II diabetes mellitus include people who:. These tests also can be used to monitor the disease once the ...
http://diet.com/g/diabetes-mellitus
*  Which Contraceptive Is Best for Women With Diabetes Mellitus? | ConsultantLive
Which Contraceptive Is Best for Women With Diabetes Mellitus. ConsultantLive. Skip to main content. Search For... Search. ConsultantLive SearchMedica. Topics: Atrial Fibrillation. Cardiovascular Diseases. COPD. Men s Health. Diabetes Type 2. Pain. HIV AIDS. Nervous System Diseases. Obesity. Respiratory Diseases. Browse All Topics All Topics Atrial Fibrillation Cardiovascular Diseases COPD Men's Health Diabetes Type 2 Pain HIV AIDS Nervous System Diseases Obesity Respiratory Diseases. MAIN MENU Home Topics Dermatology Cardiovascular Diabetes GI HIV/AIDS Conferences Quizzes Photoclinic Image IQ Pediatrics. Welcome Guest. Login or Register Welcome My Account. My Account or Logout. Connect to other sites within the UBM Medica Network. Search For... Search. ConsultantLive SearchMedica. Topics: Atrial Fibrillation. Cardiovascular Diseases. COPD. Men s Health. Diabetes Type 2. Pain. HIV AIDS. Nervous System Diseases. Obesity. Respiratory Diseases. Browse All Topics All ...
http://consultantlive.com/contraception/which-contraceptive-best-women-diabetes-mellitus
*  Treatment Implications for Comorbid Diabetes Mellitus and Depression | ConsultantLive
Treatment Implications for Comorbid Diabetes Mellitus and Depression. ConsultantLive. Skip to main content. Search For... Search. ConsultantLive SearchMedica. Topics: Atrial Fibrillation. Cardiovascular Diseases. COPD. Men s Health. Diabetes Type 2. Pain. HIV AIDS. Nervous System Diseases. Obesity. Respiratory Diseases. Browse All Topics All Topics Atrial Fibrillation Cardiovascular Diseases COPD Men's Health Diabetes Type 2 Pain HIV AIDS Nervous System Diseases Obesity Respiratory Diseases. MAIN MENU Home Topics Dermatology Cardiovascular Diabetes GI HIV/AIDS Conferences Quizzes Photoclinic Image IQ Pediatrics. Welcome Guest. Login or Register Welcome My Account. My Account or Logout. Connect to other sites within the UBM Medica Network. Search For... Search. ConsultantLive SearchMedica. Topics: Atrial Fibrillation. Cardiovascular Diseases. COPD. Men s Health. Diabetes Type 2. Pain. HIV AIDS. Nervous System Diseases. Obesity. Respiratory Diseases. Browse All Topics ...
http://consultantlive.com/major-depressive-disorder/treatment-implications-comorbid-diabetes-mellitus-and-depression
*  Ask.com - What's Your Question?
Answers. Please provide rating before submitting your feedback. Please provide feedback before submitting your response. Thanks for the feedback. Type Two Diabetes. Diabetes Type 2 Signs and Symptoms. Diabetes Diet. List of Foods for Diabetic to Eat. Different Types of Diabetes. Type 2 Diabetes Causes. Diabetes is a condition that arises when the body fails to produce sufficient insulin or fails to use insulin correctly. Insulin is a hormone used by the body for the conversion of food, principally sugar, into energy. Source: www.ehow.com. Diabetes mellitus type 2. en.wikipedia.org/wiki/Diabetes mellitus type 2. The development of type 2 diabetes is caused by a combination of lifestyle and genetic factors. While some of these factors are ... Type 2 diabetes develops when the body becomes resistant to insulin or when the pancreas stops producing enough insulin. Type 2 Diabetes Causes and Risk Factors - WebMD. ...
http://ask.com/web?q=Cause of Diabetes Type 2&oo=2603&o=0&l=dir&qsrc=3139&gc=1&qo=popularsearches
*  What’s New at the National Diabetes Education Program
Outreach and Promotions As part of their National Diabetes Month 2011 promotions, the Texas Diabetes Institute used NDEP’s resources to reach minority populations with diabetes – and health care professionals working with patients who have diabetes – with tools and messages to help people make behavior changes to live well. November is National Diabetes Month Sep 14, 2012 This November, in observance of National Diabetes Month, the National Diabetes Education Program NDEP and its partners are Changing the Way Diabetes is Treated by helping people better understand how to make the necessary changes in their day-to-day life in order to prevent type 2 diabetes, manage their diabetes to prevent complications, and live healthier lives. September Partner Spotlight Aug 31, 2012 The National Association of School Nurses Promotes NDEP’s School Guide and Other Resources via Workshops and Online Outreach Background The mission of the National ...
http://ndep.nih.gov/whats-new/index.aspx?id=86&back=true
*  Action to Control Cardiovascular Risk in Diabetes (ACCORD) Trial - NHLBI, NIH
Action to Control Cardiovascular Risk in Diabetes ACCORD Trial - NHLBI, NIH. National Institutes of Health. Accessible Search Form Search the NHLBI, use the drop down list to select: the entire site, the Health Topics section only, or the News and Resources section. NHLBI Entire Site. NHLBI Entire Site. News Resources. Contact The Health Information Center. Health Professionals. Systematic Evidence Reviews Clinical Practice Guidelines. Clinical Trials. What Are Clinical Trials. NHLBI Trials At NIH Clinical Center. News Resources. NHLBI In the News. Health Professionals ». Resources for Health Professionals ». Heart and Vascular Resources » Action to Control Cardiovascular Risk in Diabetes ACCORD Trial. Health Professionals Systematic Evidence Reviews Clinical Practice Guidelines Resources. Action to Control Cardiovascular Risk in Diabetes ACCORD Trial. Effects of Intensive Blood Pressure and Combination Lipid Therapies in Type 2 Diabetes Announcements — March 14, 2008. New ...
http://nhlbi.nih.gov/health-pro/resources/heart/accord-trial
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. I Have Diabetes. Am I at Risk. About NDEP. Health Care Professionals. You are here: NDEP Home. Resources. Diabetes HealthSense. Be Active When You Have Diabetes. National Institute of Diabetes and Digestive and Kidney Diseases NIDDK. National Institute of Diabetes and Digestive and Kidney Diseases NIDDK. This guide will help you fit physical activity into your life—your way. Exercise & Physical Activity: Your Everyday Guide. This guide shows you ...
http://ndep.nih.gov/resources/diabetes-healthsense/Index.aspx?terms=8,47,44
*  Ask.com - What's Your Question?
Answers. Please provide rating before submitting your feedback. Please provide feedback before submitting your response. Actos Pioglitazone Dosage. Side Effects of Pioglitazone. Pioglitazone Oral Dosage. Actos. Metformin Side Effects. Find Health Information on Healthline. Source. Healthline is the leading provider of health information. en.wikipedia.org/wiki/Pioglitazone. Pioglitazone is used for the treatment of diabetes mellitus type 2 either alone or in combination with a sulfonylurea, metformin, or insulin. Do We Still Need Pioglitazone for the Treatment of Type 2 Diabetes ... The disease now affects 10% of adults ... Pioglitazone for type 2 diabetes mellitus. Pioglitazone for type 2 diabetes mellitus. Pioglitazone : a review of its use in type 2 diabetes mellitus. Pioglitazone : a review of its use in type 2 diabetes mellitus. FDA OKs Generic Actos for Type 2 Diabetes - WebMD. ...
http://ask.com/web?q=Pioglitazone for Type II Diabetes&oo=2603&o=0&l=dir&qsrc=3139&gc=1&qo=popularsearches
*  Older Women With Type II Diabetes at Greater Risk of Breast Cancer [VIDEO]
Older Women With Type II Diabetes at Greater Risk of Breast Cancer. International Business Times UK. Cancer. Older Women With Type II Diabetes at Greater Risk of Breast Cancer. Post- menopausal women with type II diabetes are at higher risk of developing breast cancer. Post-menopausal women with type II diabetes are at higher risk of developing breast cancer, researchers from the International Prevention Research Institute i-PRI and Cancer Research UK have found. A study conducted on 56,000 breast cancer patients across four continents has found that post-menopausal women with type II diabetes have a 27 per cent increased risk of breast cancer. The study did not find the same link between women of pre-menopausal age or those with type I diabetes. "Our study found a significantly increased risk of breast cancer in women who had diabetes, which was restricted to those of post-menopausal age," said Professor Peter Boyle, President of i-PRI. "We don't yet know the ...
http://ibtimes.co.uk/older-women-type-ii-diabetes-greater-risk-385058
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Press. I Have Diabetes. Am I at Risk. Health Care Professionals, Businesses Schools. About NDEP. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. Diabetes HealthSense. This guide will help you fit physical activity into your life—your way. Exercise & Physical Activity: Your Everyday Guide. This guide ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=31,47,44,10
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Press. I Have Diabetes. Am I at Risk. Health Care Professionals, Businesses Schools. About NDEP. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. Diabetes HealthSense. This guide will help you fit physical activity into your life—your way. Exercise & Physical Activity: Your Everyday Guide. This guide ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=31,47,44,7
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Press. I Have Diabetes. Am I at Risk. Health Care Professionals, Businesses Schools. About NDEP. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. Diabetes HealthSense. This guide will help you fit physical activity into your life—your way. Exercise & Physical Activity: Your Everyday Guide. This guide ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=31,47,44,9
*  UM Research Repository
... Items where Journal is Diabetes Research and Clinical Practice. Export as Dublin Core EP3 XML EndNote HTML Citation JSON METS OAI-ORE Resource Map Atom Format OAI-ORE Resource Map RDF Format Object IDs OpenURL ContextObject RDF+N-Triples RDF+N3 RDF+XML Refer Reference Manager. RSS 2.0. RSS 1.0. Atom. Item Type. Jump to: A. ; Mustafa, M.R. Diabetes Research and Clinical Practice, 73 1. ISSN 0168-8227. I Ismail, I.S. 1994 A glimpse of the 'natural history' of established Type 2 non-insulin dependent diabetes mellitus from the spectrum of metabolic and hormonal responses to a mixed meal at the time of diagnosis. Diabetes Research and Clinical Practice, 26 3. ISSN 0168-8227. Ismail, I.S. ; Nazaimoon, W.M.W. ; Mohamad, W.B.W. ; Letchuman, R. ; Singaraveloo, M. ; Pendek, R. ; Faridah, I. ; Rasat, R. ; Sheriff, I.H. ; Khalid, B.A.K. 2000 Socioedemographic determinants of glycaemic control in young diabetic patients in peninsular Malaysia. Diabetes Research and Clinical ...
http://eprints.um.edu.my/view/publication/Diabetes_Research_and_Clinical_Practice.html
*  BI 10773 (Empagliflozin) Cardiovascular Outcome Event Trial in Type 2 Diabetes Mellitus Patients (EM
BI 10773 Empagliflozin Cardiovascular Outcome Event Trial in Type 2 Diabetes Mellitus Patients EMPA-REG OUTCOME. - No Study Results Posted - ClinicalTrials.gov. National Institutes of Health Example: "Heart attack" AND "Los Angeles" Search for studies:. Advanced Search. Help. Studies by Topic. Glossary. Find Studies. Advanced Search. See Studies by Topic. See Studies on Map. How to Search. How to Use Search Results. How to Find Results of Studies. How to Read a Study Record. About Clinical Studies. Learn About Clinical Studies. Other Sites About Clinical Studies. Glossary of Common Site Terms. Submit Studies. Why Should I Register and Submit Results. How to Register Your Study. How to Edit Your Study Record. How to Submit Your Results. Resources. Selected Publications. RSS Feeds. About This Site. ClinicalTrials.gov Background. Terms and Conditions. Disclaimer. Find Studies Study Record Detail. BI 10773 Empagliflozin Cardiovascular Outcome Event Trial in Type 2 Diabetes Mellitus ...
https://clinicaltrials.gov/ct2/show/results/NCT01131676?show_locs=Y
*  National Diabetes Prevention underway - The Deming Headlight
... Font Resize National Diabetes Prevention underway NMSU, Molina Healthcare are providers. Darren Phillips NMSU Photo Gaby Phillips, program coordinator and lifestyle coach for the National Diabetes Prevention Program, reviews the program curriculum during a training exercise with students and colleagues. New Mexico State University's Cooperative Extension Service is partnering with Molina Healthcare to provide the Centers for Disease Control and Prevention's National Diabetes Prevention Program to help participants adopt healthy lifestyle habits. "If a person has a family member with diabetes, it is not inevitable that they will get diabetes if they work to turn around their eating and exercise habits," said Lucinda Banegas-Carreon, NMSU coordinator of the program. "With the information and encouragement provided by our lifestyle coaches, we hope the participants in the program will have the tools to make the necessary steps to delay or prevent diabetes." ...
http://archive.demingheadlight.com/ci_23688400/national-diabetes-prevention-underway?source=most_viewed
*  Health economics of diabetes prevention | International Diabetes Federation
Health economics of diabetes prevention. Resources. IDF Europe Publications. Contact us. The cost-effectiveness of interventions aimed at halting or slowing the progress of impaired glucose tolerance to type 2 diabetes has been examined in a number of clinical trials and computer modeling simulations. The obvious implication of these findings is that early intervention and delay or avoidance of progression to type 2 diabetes is of enormous benefit, both to patients in terms of increasing life expectancy LE and quality of life, and potentially in economic terms for society and healthcare payers. In the absence of long-term follow up data 10 years from diabetes prevention studies, computer simulation modeling represents the best available approach to evaluate the long-term clinical and economic impact of diabetes prevention programmes. A number of research groups have applied modeling technology to project the long-term clinical and cost benefits associated with a number of ...
https://idf.org/diabetes-prevention/health-economics?language=ar
*  Diabetes HealthSense | NDEP
NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. I Have Diabetes. Am I at Risk. Prevent Type 2 Diabetes: Step by Step Prevengamos la diabetes tipo 2. This website gives kids ages 9 to 13 the information they need to make healthy lifestyle choices. Centers for Disease Control and Prevention CDC. This tip sheet helps African Americans at risk for type 2 diabetes move more and eat less to lower their risk for diabetes. National Diabetes Education Program NDEP. ChooseMyPlate.gov from the USDA illustrates the five food groups that are the building blocks for a healthy diet and provides tools for diet/calorie tracking and information on weight management, physical activity, and healthy eating. Centers for Disease Control CDC. This toolkit assists parents in helping their children make healthy food choices and start healthy habits to prevent diabetes. En ...
http://ndep.nih.gov/resources/diabetes-healthsense/Index.aspx?terms=1,46&sort=0&page=-1
*  PF-06291874 Multiple Ascending Dose Study In Type 2 Diabetes Mellitus Patients - No Study Results Po
... sted - ClinicalTrials.gov. Skip to Main Content. National Institutes of Health Example: "Heart attack" AND "Los Angeles" Search for studies:. Advanced Search. Help. Studies by Topic. Glossary. Find Studies. Basic Search. Advanced Search. See Studies by Topic. See Studies on Map. How to Search. How to Use Search Results. How to Find Results of Studies. How to Read a Study Record. About Clinical Studies. Learn About Clinical Studies. Other Sites About Clinical Studies. Glossary of Common Site Terms. Submit Studies. Why Should I Register and Submit Results. How to Register Your Study. How to Edit Your Study Record. How to Submit Your Results. Support Materials. Training Materials. Resources. Clinical Alerts and Advisories. RSS Feeds. Trends, Charts, and Maps. Downloading Content for Analysis. About This Site. ClinicalTrials.gov Background. History, Policies, and Laws. Media/Press Resources. Linking to This Site. Terms and Conditions. Disclaimer. Text Size. Find Studies Study Record Detail. PF-06291874 ...
https://clinicaltrials.gov/ct2/show/results/NCT01856595?show_rss=Y&sel_rss=mod14
*  What Is Diabetes?
Diabetes mellitus is a pancreatic disorder caused when the pancreas produces insufficient or no insulin. Diabetes mellitus is a pancreatic disorder caused when the pancreas produces insufficient or no insulin. Insulin is the hormone responsible for the absorption of glucose into cells for energy needs and into the liver and fat cells for storage. When this does not occur, the level of glucose in the blood becomes abnormally high. When the body cannot store or use glucose, the body weight decreases and fatigue is present. The two other types of diabetes are diabetes bronze and diabetes insipidus. Diabetes bronze is another name for hemochromatosis, a rare disease where excessive amounts of iron are deposited in the tissues such as the liver, pancreas, and skin. The name of this disease comes from the bronze skin coloration and diabetes mellitus that usually develops in people who suffer from this disorder. Diabetes insipidus is a ...
http://allsands.com/health/diseases/health/diseases/whatisdiabetes_yai_gn.htm
*  Do heart benefits of statins outweigh diabetes risk? - Selkirk Weekend Advertiser
Do heart benefits of statins outweigh diabetes risk. with your email account Email Address {* traditionalSignIn emailAddress *} Password {* traditionalSignIn password *}. with your email account {* traditionalSignIn emailAddress *} {* traditionalSignIn password *}. The key findings of the study were that: The researchers calculated that by treating the roughly 11,000 people in this trial who had risk factors for diabetes, 134 CVDs or deaths would be avoided for every 54 extra cases of diabetes caused. The study population were people with no history of cardiovascular disease events; that is, the study was looking at the use of statins for primary prevention of cardiovascular disease use of statins in people who have already had a heart attack or stroke would be secondary prevention. When analysed separately by group, for people with one or more risk factor for diabetes, statin treatment gave: People without diabetes risk factors had: The researchers calculated that if the ...
http://selkirkweekendadvertiser.co.uk/news/health/behind-the-headlines/do-heart-benefits-of-statins-outweigh-diabetes-risk-1-2462410
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. Search NDEP site. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Diabetes Facts. Press. I Have Diabetes. Am I at Risk. Health Care Professionals, Businesses Schools. About NDEP. Contact Us. Site Map. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. Diabetes HealthSense. Resource Name A-Z Resource Name Z-A No Cost No Registration No Cost or ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=1,42,46,31
*  Clinical Research Trial Listing 159181, Diabetes Mellitus Types I and II, Diablo Clinical Researc
... h 5194 in Walnut Creek, CA. CenterWatch. Clinical Trials. Search Clinical Trials. Overview of Clinical Trials. Post Clinical Trials. Drugs in Clinical Trials Database. Patient Resources. Other Patient Organizations. Industry Resources. CenterWatch News Online. Clinical Trials Data Library. CenterWatch News Online. About CenterWatch. Contact Us. CenterWatch in the News. Clinical Trials. Therapeutic Areas Therapeutic Areas: Endocrinology. Family Medicine Disease Category: Diabetes Mellitus Types I and II Location:. Clinical Trial Details Overview. Volunteer/Contact. Overview Research Study Summary Do you have type 2 diabetes. If so, you may be eligible to be in a clinical research study evaluating the safety and effectiveness of an investigational medication for the treatment of type 2 diabetes. Eligible volunteers will receive study related:. Physical exams and ECGs Lab tests Investigational medication s or placebo Diet and Exercise counseling Glucometer and blood sugar testing ...
http://centerwatch.com/clinical-trials/listings/studydetails.aspx?StudyID=159181
*  Efficacy of 500µg Roflumilast Once Daily Versus Placebo Over 12 Weeks in Patients With Diabetes Mel
Efficacy of 500 g Roflumilast Once Daily Versus Placebo Over 12 Weeks in Patients With Diabetes Mellitus Type 2. Efficacy of 500 g Roflumilast Once Daily Versus Placebo Over 12 Weeks in Patients With Diabetes Mellitus Type 2. Diabetes Mellitus Type 2. Official Title: Efficacy of 500 g Roflumilast Once Daily Versus Placebo Over 12 Weeks in Patients With Diabetes Mellitus Type 2. Mean change from baseline to each scheduled post-randomization visit and Vlast based on a 5-hour period post meal area under the curve AUC for FFA, glycerol, glucose, glucagons, insulin, and C-peptide Mean change in body weight, waist and hip circumference, waist to hip ratio, and body mass index BMI from baseline to each scheduled post-randomization visit and Vlast Time to event study withdrawal, time to study withdrawal due to an adverse event AE and time to lack of efficacy LOE. Main Exclusion Criteria: patients diagnosed with type 1 diabetes or diabetes ...
https://clinicaltrials.gov/show/NCT01140542
*  isuzu-miedzy-glor (shooting-co-flora) - Blogi.pl
Article diabetes insulin mellitus Diabetes insulin mellitus resistant Diabetes mellitus pathophysiology s disease, Parkinson s disease, heart disease, diabetes mellitus type 2, cirrhosis of the liver, ref Klatsky Diabetes mellitus Types of Diabetes Diabetes mellitus type 1 Diabetes mellitus type 2 Gestational diabetes Recommendations mellitus for mellitus antibiotic therapy in persons with diabetes mellitus. As related to the quality in the patients with type 2 diabetes mellitus and its influence on their quality of life. Inslin dependent and diabetes insulon type. Przemysława Jarosz-Chobot, mellitus Joanna Polańska Termin cukrzyca diabetes mellitus obejmuje grupę chorób metabolicznych charakteryzujących mellitus się podwyższonym stężeniem starsze panie kupic naltrexon wielkie loga -linkin park tlumaczenia rondo 1 pytania ...
http://isuzu-miedzy-glor.blogi.pl/
*  A Study of Taspoglutide in Patients With Inadequately Controlled Diabetes Mellitus Type 2 and Cardio
... vascular Disease - No Study Results Posted - ClinicalTrials.gov. Skip to Main Content. A service of the U.S. National Institutes of Health Example: "Heart attack" AND "Los Angeles" Search for studies:. Advanced Search. Help. Studies by Topic. Glossary. Find Studies. Basic Search. Advanced Search. See Studies by Topic. See Studies on Map. How to Search. How to Use Search Results. How to Find Results of Studies. How to Read a Study Record. About Clinical Studies. Learn About Clinical Studies. Other Sites About Clinical Studies. Glossary of Common Site Terms. Submit Studies. Why Should I Register and Submit Results. FDAAA 801 Requirements. How to Apply for an Account. How to Register Your Study. How to Edit Your Study Record. How to Submit Your Results. Frequently Asked Questions. Support Materials. Training Materials. Resources. Selected Publications. Clinical Alerts and Advisories. RSS Feeds. Trends, Charts, and Maps. Downloading Content for Analysis. About This Site. ClinicalTrials.gov Background. About ...
https://clinicaltrials.gov/ct2/show/results/NCT01018173?term="Type 2 Diabetes"&lup_s=09/20/2013&lup_d=14&show_rss=Y&sel_rss=mod14
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. To email this page, please copy the link from your browser's address bar, open your email program, and paste the link. To bookmark this page, please copy and paste the link from your browser's address bar, then use your "Bookmarks" or "Favorites" menu to add the page to your favorites. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Diabetes Facts. I Have Diabetes. About NDEP. Site Map. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. Diabetes HealthSense. ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=12,42,47,111
*  He Purongo Mo Nga Kai Hei Arai i Te Matehuka – Dietary Diabetes Prevention Study for Maori - Full
He Purongo Mo Nga Kai Hei Arai i Te Matehuka Dietary Diabetes Prevention Study for Maori - Full Text View - ClinicalTrials.gov. National Institutes of Health Example: "Heart attack" AND "Los Angeles" Search for studies:. ClinicalTrials.gov Background. He Purongo Mo Nga Kai Hei Arai i Te Matehuka Dietary Diabetes Prevention Study for Maori This study has been completed. Sponsor: Edgar National Centre for Diabetes Research Information provided by: Edgar National Centre for Diabetes Research. ClinicalTrials.gov Identifier: NCT00208637 First received: September 13, 2005 Last updated: NA Last verified: September 2005 History: No changes posted. The purpose of this study was to compare the metabolic effects of a moderate carbohydrate, high protein diet MCHP with a high carbohydrate-high fibre HCHF diet on insulin sensitivity in Maori at increased risk of developing diabetes and cardiovascular disease. Behavioral: moderate carbohydrate, high protein diet MCHP Behavioral: high ...
https://clinicaltrials.gov/ct2/show/NCT00208637
*  Clinical Research Trial Listing 37894, Diabetes Mellitus Types I and II, Division of Molecular Ge
... netics 96 in New York, NY. CenterWatch. . Search. Menu. Clinical Trials. Overview. Search Clinical Trials. Patient Notification Service. Overview of Clinical Trials. Volunteering for a Trial. Understanding Informed Consent. Post Clinical Trials. Drug Information. Overview. Drugs in Clinical Trials Database. FDA Approved Drugs. Trial Results New Medical Therapies™. Patient Resources. Overview. Health Associations. Other Patient Organizations. Blogs and Support Groups. Glossary. Industry Resources. Overview. CenterWatch News Online. White Papers. Research Center Profiles. Industry Provider Profiles. TrialWatch Services. Market Analytics Services. Clinical Trials Data Library. Team Performance Optimization Process. Training Guides. Content Licensing. General Industry Resources. News Publications. CenterWatch News Online. The CenterWatch Monthly. CWWeekly. Research Practitioner. Renew your subscriptions. Subscribe today. Shop. JobWatch. About Us. About CenterWatch. Contact Us. Advertise. FAQ. Events. Team ...
http://centerwatch.com/clinical-trials/listings/studydetails.aspx?StudyID=37894
*  Diabetes Mellitus - Nursing Link
Search Jobs. Diabetes mellitus is a group of diseases characterized by high levels of blood glucose resulting from defects in insulin production, insulin action, or both. Women who have had gestational diabetes have a 20% to 50% chance of developing diabetes in the next 5-10 years. Many people with type 2 diabetes can control their blood glucose by following a careful diet and exercise program, losing excess weight, and taking oral medication. Many people with diabetes also need to take medications to control their cholesterol and blood pressure. Among adults with diagnosed diabetes, 12% take both insulin and oral medications, 19% take insulin only, 53% take oral medications only, and 15% do not take either insulin or oral medications. People with prediabetes have impaired fasting glucose IFG or impaired glucose tolerance IGT. Some people may have both IFG and IGT. adults aged 40-74 years who were tested from 1988 to 1994, 33.8% had IFG , 15.4% had IGT ...
http://nursinglink.monster.com/training/articles/893-diabetes-mellitus
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To email this page, please copy the link from your browser's address bar, open your email program, and paste the link. To bookmark this page, please copy and paste the link from your browser's address bar, then use your "Bookmarks" or "Favorites" menu to add the page to your favorites. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. I Have Diabetes. Am I at Risk. About NDEP. HealthSense Home. Health Care ...
http://ndep.nih.gov/resources/diabetes-healthsense/index.aspx?terms=8,31,44&sort=0&page=-1
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To email this page, please copy the link from your browser's address bar, open your email program, and paste the link. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. Diabetes Facts. Press. I Have Diabetes. Am I at Risk. Health Care Professionals, Businesses Schools. About NDEP. Contact Us. Site Map. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. ...
http://ndep.nih.gov/resources/diabetes-healthsense/Index.aspx?terms=8,42,31
*  Diabetes Mellitus
... Logging In. Email:. Password:. Remember Me. Forgot Password. Sign Up. Connect w/Facebook. Home. Lecture Hall. eTalk. eZines. About Us. Classifieds. Mentor LMS. More ▼. Contact Us. Important Links. Sponsors. Help & Support. Lecture Hall. General Diabetes. Review. Purchase History. Check out. My Cart 0. . LECTURE S IN YOUR SHOPPING CART You have no lectures in your cart. 0 Lecture s Subtotal: $ 0.00. Diabetes Mellitus. $15.00. 1 Year Subscription. Available Credits CPME 0.75. Jeffrey M. Robbins,. Director, Podiatry Services VA Central Office Louis Stokes Cleveland VAMC Cleveland, OH. System Requirements Method of Participation Disclosure Information Lecture Transcription. The chronic hyperglycemia of diabetes is associated with long term damage, dysfunction and failure of various organs; especially the eyes, kidneys, nerves, heart and blood vessels. The risk of heart disease and stroke is 2-4 times greater in patients with diabetes. Diabetes is the leading ...
https://presentdiabetes.com/lecture_hall/description.php?id=28
*  Epigenetics of diabetes Type 2
... Using bisulfite testing, it was also found that there was an approximately twofold increase in DNA methylation of the PPARGC1A promoter of human islet cells from diabetics as compared to non-diabetic human islet cells. In human type 2 diabetic islets, reduced PPARGC1A mRNA levels were associated with impaired glucose-mediated insulin secretion. In a different study where transcriptional changes due to a risk factors for diabetes, were examined, changes in the methylation patterns of the PPARGC1A gene were also found. 2 Another risk factor is low birth weight LBW, and in a study done on that, it was found that there was increased DNA methylation in the LBW patients' muscle cells. Furthermore, Pdx1 also mediated β-cell-specific expression of SET7/9, which may regulate genes involved in glucose-induced insulin secretion. In humans it has been shown that inflammatory gene expression induced by diabetic stimuli like high glucose and a RAGE ligand S100B was associated with increased H3K9/14Ac genome ...
https://en.wikipedia.org/wiki/Epigenetics_of_diabetes_Type_2
*  "Look AHEAD Study--"Negative Result"": Diabetes Community - Support Group
Look AHEAD Study-- Negative Result : Diabetes Community - Support Group. Announcements Welcome to WebMD's Diabetes Community How and Why to Report a Post. posted: The Look AHEAD study tested the effectiveness of lifestyle coaching caloric reduction and increased exercise and weight loss compared to a usual care control group with no weight loss for reducing rates of cardiovascular events in overweight patients with type 2 diabetes over the course of up to 11 years. The study was halted last week--two years early--because there was no difference in cardiovascular events between the lifestyle coaching group and the usual care control group. Share this: Look AHEAD Study--"Negative Result" The Look AHEAD study tested the effectiveness of lifestyle coaching caloric reduction and increased exercise and weight loss compared to a usual care control group with no weight loss for reducing rates of cardiovascular events in overweight patients with type 2 diabetes over the course of up to ...
http://forums.webmd.com/3/diabetes-exchange/forum/8916/6
*  Study Of Denagliptin In Subjects With Type 2 Diabetes Mellitus (T2DM) - Full Text View - ClinicalTri
Study Of Denagliptin In Subjects With Type 2 Diabetes Mellitus T2DM - Full Text View - ClinicalTrials.gov. National Institutes of Health Example: "Heart attack" AND "Los Angeles" Search for studies:. Find Studies. How to Search. How to Use Search Results. How to Find Results of Studies. How to Read a Study Record. About Clinical Studies. Learn About Clinical Studies. Other Sites About Clinical Studies. Submit Studies. How to Edit Your Study Record. RSS Feeds. ClinicalTrials.gov Background. Terms and Conditions. Find Studies Study Record Detail. Study Of Denagliptin In Subjects With Type 2 Diabetes Mellitus T2DM This study has been withdrawn prior to enrollment. Study cancelled before enrollment Sponsor: GlaxoSmithKline Information provided by: GlaxoSmithKline. ClinicalTrials.gov Identifier: NCT00387972 First received: October 12, 2006 Last updated: April 15, 2015 Last verified: April 2015 History of Changes. How to Read a Study Record. The purpose of the Study is to evaluate the ...
https://clinicaltrials.gov/ct2/show/NCT00387972
*  Baker IDI Heart and Diabetes Institute
... The Baker Heart Research Institute. Basil Corkill described the methods of diagnosis and treatment of diabetes mellitus at the Alfred Hospital in 1927. The research on surgery lead to the development of cardiac surgery at the Alfred Hospital. The International Diabetes Institute 1984–2008. Baker IDI Heart and Diabetes Institute 2008–Present. In 2008 the Baker Heart Research Institute, as it was then known, merged with the International Diabetes Institute which had operated in Melbourne for over 25 years. The aims of research at Baker IDI are to increase understanding of the basic causes of heart disease and diabetes, their risk factors and the links between diabetes, metabolism, lifestyle, and the development of serious health complications, particularly heart, stroke and vascular disease. Jan;8 1 :335-45 Described an assay for glutamic acid decarboxylase to discriminate major types of diabetes mellitus Rowley M, Mackay I, Chen Q, Knowles W, ...
https://en.wikipedia.org/wiki/Baker_IDI_Heart_and_Diabetes_Institute
*  Diabetes HealthSense | NDEP
Diabetes HealthSense. NDEP. department of health and human services To print this page, please use your browser's File menu and select print. To email this page, please copy the link from your browser's address bar, open your email program, and paste the link. To make the text on this page larger or smaller: PCs: Press the "CTRL" and "+" key at the same time to make the text bigger. "CTRL" and "-" key at the same time to make the text smaller. Macs: Press the "Command" and "+" key at the same time to make the text bigger. "Command" and "-" key at the same time to make the text smaller. NDEP is a partnership of the National Institutes of Health, the Centers for Disease Control and Prevention, and more than 200 public and private organizations. Resources. I Have Diabetes. Health Care Professionals, Businesses Schools. About NDEP. HealthSense Home. Health Care Professionals. About HealthSense. You are here: NDEP Home. Resources. Diabetes HealthSense. Resource Name A-Z Resource Name Z-A No ...
http://ndep.nih.gov/resources/diabetes-healthsense/Index.aspx?terms=42,47,12

Outline of diabetes: The following outline is provided as an overview of and topical guide to diabetes:Permanent neonatal diabetes mellitus: A newly identified and potentially treatable form of monogenic diabetes is the neonatal diabetes caused by activating mutations of the KCNJ11 gene, which codes for the Kir6.2 subunit of the beta cell KATP channel.Network for Pancreatic Organ Donors with Diabetes: The Network for Pancreatic Organ donors with Diabetes (nPOD), is a collaborative type 1 diabetes research project funded by JDRF (formerly known as the Juvenile Diabetes Research Foundation). nPOD supports scientific investigators by providing, without cost, rare and difficult to obtain tissues beneficial to their research.Blood glucose monitoring: Blood glucose monitoring is a way of testing the concentration of glucose in the blood (glycemia). Particularly important in the care of diabetes mellitus, a blood glucose test is performed by piercing the skin (typically, on the finger) to draw blood, then applying the blood to a chemically active disposable 'test-strip'.International Association of Plastics DistributorsAnti-diabetic medication: Drugs used in diabetes treat diabetes mellitus by lowering glucose levels in the blood. With the exceptions of insulin, exenatide, liraglutide and pramlintide, all are administered orally and are thus also called oral hypoglycemic agents or oral antihyperglycemic agents.Insulin signal transduction pathway and regulation of blood glucose: The insulin transduction pathway is an important biochemical pathway beginning at the cellular level affecting homeostasis. This pathway is also influenced by fed versus fasting states, stress levels, and a variety of other hormones.QRISK: QRISK2 (the most recent version of QRISK) is a prediction algorithm for cardiovascular disease (CVD) that uses traditional risk factors (age, systolic blood pressure, smoking status and ratio of total serum cholesterol to high-density lipoprotein cholesterol) together with body mass index, ethnicity, measures of deprivation, family history, chronic kidney disease, rheumatoid arthritis, atrial fibrillation, diabetes mellitus, and antihypertensive treatment.HyperglycemiaMacrovascular disease: Macrovascular disease is a disease of any large (macro) blood vessels in the body. It is a disease of the large blood vessels, including the coronary arteries, the aorta, and the sizable arteries in the brain and in the limbs.Diabetic nephropathyDiabetic neuropathyDiabetic retinopathy: ( )Classification of obesity: Obesity is a medical condition in which excess body fat has accumulated to the extent that it has an adverse effect on health.WHO 2000 p.Pine Islet LightDiabetic ketoacidosisHypertensionNested case-control study: A nested case control (NCC) study is a variation of a case-control study in which only a subset of controls from the cohort are compared to the incident cases. In a case-cohort study, all incident cases in the cohort are compared to a random subset of participants who do not develop the disease of interest.Spontaneous hypoglycemia: The term "spontaneous hypoglycemia" was coined by the physician Seale Harris. (Who stated their source to be Alabama Hall of Fame, 1968)HeartScore: HeartScore is a cardiovascular disease risk assessment and management tool developed by the European Society of Cardiology, aimed at supporting clinicians in optimising individual cardiovascular risk reduction.GliquidoneDiabetes insipidusGlucose transporterPioglitazone/metforminIncidence (epidemiology): Incidence is a measure of the probability of occurrence of a given medical condition in a population within a specified period of time. Although sometimes loosely expressed simply as the number of new cases during some time period, it is better expressed as a proportion or a rate with a denominator.DexcomTemporal analysis of products: Temporal Analysis of Products (TAP), (TAP-2), (TAP-3) is an experimental technique for studyingMicroalbuminuriaBiomarkers of aging: Biomarkers of aging are biomarkers that better predict functional capacity at a later age than chronological age. Stated another way, biomarkers of aging would give the true "biological age", which may be different from the chronological age.Global Risks Report: The Global Risks Report is an annual study published by the World Economic Forum ahead of the Forum’s Annual Meeting in Davos, Switzerland. Based on the work of the Global Risk Network, the report describes changes occurring in the global risks landscape from year to year and identifies the global risks that could play a critical role in the upcoming year.Diabetic diet: Diabetic diet refers to the diet that is recommended for people with diabetes mellitus, or high blood glucose. There is much disagreement regarding what this diet should consist of.Comorbidity: In medicine, comorbidity is the presence of one or more additional disorders (or diseases) co-occurring with a primary disease or disorder; or the effect of such additional disorders or diseases. The additional disorder may also be a behavioral or mental disorder.Age adjustment: In epidemiology and demography, age adjustment, also called age standardization, is a technique used to allow populations to be compared when the age profiles of the populations are quite different.Prenatal nutrition: Nutrition and weight management before and during :pregnancy has a profound effect on the development of infants. This is a rather critical time for healthy fetal development as infants rely heavily on maternal stores and nutrient for optimal growth and health outcome later in life.Aortic pressure: Central aortic blood pressure (CAP or CASP) is the blood pressure at the root of aorta. Studies have shown the importance of central aortic pressure and its implications in assessing the efficacy of antihypertensive treatment with respect to cardiovascular risk factors.National Cholesterol Education Program: The National Cholesterol Education Program is a program managed by the National Heart, Lung and Blood Institute, a division of the National Institutes of Health. Its goal is to reduce increased cardiovascular disease rates due to hypercholesterolemia (elevated cholesterol levels) in the United States of America.AlloxanThiazolidinedione: The thiazolidinediones , also known as glitazones, are a class of medications used in the treatment of diabetes mellitus type 2. They were introduced in the late 1990s.List of Parliamentary constituencies in Kent: The ceremonial county of Kent,Lipid droplet: Lipid droplets, also referred to as lipid bodies, oil bodies or adiposomes, are lipid-rich cellular organelles that regulate the storage and hydrolysis of neutral lipids and are found largely in the adipose tissue.Mobilization and cellular uptake of stored fats and triacylglycerol (with Animation) They also serve as a reservoir for cholesterol and acyl-glycerols for membrane formation and maintenance.Development of dipeptidyl peptidase-4 inhibitors: Dipeptidyl peptidase-4 inhibitors (DPP-4 inhibitors) are enzyme inhibitors that inhibit the enzyme dipeptidyl peptidase-4 (DPP-4) and are a potent treatment for type 2 diabetes. Inhibition of the DPP-4 enzyme prolongs and enhances the activity of incretins that play an important role in insulin secretion and blood glucose control regulation.Niigata UniversityTriglycerideCADgene: CADgene is a database of genes involved in coronary artery disease (CAD) .Diabetic foot ulcer: Diabetic foot ulcer is a major complication of diabetes mellitus, and probably the major component of the diabetic foot.Regression dilution: Regression dilution, also known as regression attenuation, is the biasing of the regression slope towards zero (or the underestimation of its absolute value), caused by errors in the independent variable.Pancreatic bud: The ventral and dorsal pancreatic buds (or pancreatic diverticula) are outgrowths of the duodenum during human embryogenesis. They join together to form the adult pancreas.Glucagon-like peptide-2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).Renal threshold: In physiology, the renal threshold is the concentration of a substance dissolved in the blood above which the kidneys begin to remove it into the urine. When the renal threshold of a substance is exceeded, reabsorption of the substance by the proximal convoluted tubule is incomplete; consequently, part of the substance remains in the urine.Nathan W. LevinAutoantibody: An autoantibody is an antibody (a type of protein) produced by the immune system that is directed against one or more of the individual's own proteins. Many autoimmune diseases, (notably lupus erythematosus), are caused by such autoantibodies.Glucose clamp technique: Glucose clamp technique is a method for quantifying insulin secretion and resistance. It is used to measure either how well an individual metabolizes glucose or how sensitive an individual is to insulin.Amylin family: In molecular biology, the amylin protein family or calcitonin/CGRP/IAPP protein family is a family of proteins, which includes the precursors of calcitonin/calcitonin gene-related peptide (CGRP), islet amyloid polypeptide (IAPP) and adrenomedullin.Closed-ended question: A closed-ended question is a question format that limits respondents with a list of answer choices from which they must choose to answer the question.Dillman D.Robinson Rancheria of Pomo Indians of California: The Robinson Rancheria of Pomo Indians of California is a federally recognized tribe of Eastern Pomo people in Lake County, California.California Indians and Their Reservations.Tumor progression: Tumor progression is the third and last phase in tumor development. This phase is characterised by increased growth speed and invasiveness of the tumor cells.

(1/10340) Leptin suppression of insulin secretion and gene expression in human pancreatic islets: implications for the development of adipogenic diabetes mellitus.

Previously we demonstrated the expression of the long form of the leptin receptor in rodent pancreatic beta-cells and an inhibition of insulin secretion by leptin via activation of ATP-sensitive potassium channels. Here we examine pancreatic islets isolated from pancreata of human donors for their responses to leptin. The presence of leptin receptors on islet beta-cells was demonstrated by double fluorescence confocal microscopy after binding of a fluorescent derivative of human leptin (Cy3-leptin). Leptin (6.25 nM) suppressed insulin secretion of normal islets by 20% at 5.6 mM glucose. Intracellular calcium responses to 16.7 mM glucose were rapidly reduced by leptin. Proinsulin messenger ribonucleic acid expression in islets was inhibited by leptin at 11.1 mM, but not at 5.6 mM glucose. Leptin also reduced proinsulin messenger ribonucleic acid levels that were increased in islets by treatment with 10 nM glucagon-like peptide-1 in the presence of either 5.6 or 11.1 mM glucose. These findings demonstrate direct suppressive effects of leptin on insulin-producing beta-cells in human islets at the levels of both stimulus-secretion coupling and gene expression. The findings also further indicate the existence of an adipoinsular axis in humans in which insulin stimulates leptin production in adipocytes and leptin inhibits the production of insulin in beta-cells. We suggest that dysregulation of the adipoinsular axis in obese individuals due to defective leptin reception by beta-cells may result in chronic hyperinsulinemia and may contribute to the pathogenesis of adipogenic diabetes.  (+info)

(2/10340) Obstructive uropathy and hydronephrosis in male KK-Ay mice: a report of cases.

Uropathy associated with hydronephrosis was observed frequently in our male KK-Ay mouse colony during a long-term study of diabetes. The lesion occurred in 24 of the 31 KK-Ay male mice and accounted for the greatest number of spontaneous deaths among them. It was observed after 4 months of age and involved about hard plugs of altered seminal material resembling the seminal vesicle secretion. The plugs became impacted in the urethral bulb and the bladder. The penile anatomy, with its flexure, pressure on the urethra from the bulbocavernosus muscle, and the characteristic ability of the seminal fluid to easily coagulate to form the vaginal plug may have contributed to the lesion. Correlation between development of the uropathy and diabetes has not been established.  (+info)

(3/10340) Role of glutamine in human carbohydrate metabolism in kidney and other tissues.

Glutamine is the most abundant amino acid in the human body and is involved in more metabolic processes than any other amino acid. Until recently, the understanding of many aspects of glutamine metabolism was based on animal and in vitro data. However, recent studies using isotopic and balance techniques have greatly advanced the understanding of glutamine metabolism in humans and its role in glucose metabolism in the kidney and other tissues. There is now evidence that in postabsorptive humans, glutamine is an important glucose precursor and makes a significant contribution to the addition of new carbon to the glucose carbon pool. The importance of alanine for gluconeogenesis, viewed in terms of the addition of new carbons, is less than previously assumed. It appears that glutamine is predominantly a renal gluconeogenic substrate, whereas alanine gluconeogenesis is essentially confined to the liver. As shown recently, renal gluconeogenesis contributes 20 to 25% to whole-body glucose production. Moreover, glutamine has been shown not only to stimulate net muscle glycogen storage but also to stimulate gluconeogenesis in normal humans. Finally, in humans with type II diabetes, conversion of glutamine to glucose is increased (more so than that of alanine). The available evidence on the hormonal regulation of glutamine gluconeogenesis in kidney and liver and its alterations under pathological conditions are discussed.  (+info)

(4/10340) Prevalence of hepatitis B surface antigen and antibody in white and black patients with diabetes mellitus.

The prevalence of hepatitis B surface antigen (HBSAg) and antibody (anti-HBS) was determined in 531 white and 519 black diabetic outpatients and in appropriate white and black control populations. There was no difference between the prevalence of either HBSAg or anti-HBS in either the white or black diabetics and that in the white and black controls. These findings make it unlikely that the vast majority of patients with diabetes mellitus have either an increased susceptibility to infection by the hepatitis B virus or an impaired ability to clear the virus once they are infected.  (+info)

(5/10340) An audit of the care of diabetics in a group practice.

The diabetics in a general practice of 20,175 patients were identified during one year and 119 were found-a prevalence of 5.9 per thousand.The age and sex distribution, method of treatment, criteria of diabetic control, complications, and present method of care were analysed from the medical records to examine the process of medical care of a chronic disease in general practice.  (+info)

(6/10340) Regulation of fatty acid homeostasis in cells: novel role of leptin.

It is proposed that an important function of leptin is to confine the storage of triglycerides (TG) to the adipocytes, while limiting TG storage in nonadipocytes, thus protecting them from lipotoxicity. The fact that TG content in nonadipocytes normally remains within a narrow range, while that of adipocytes varies enormously with food intake, is consistent with a system of TG homeostasis in normal nonadipocytes. The facts that when leptin receptors are dysfunctional, TG content in nonadipocytes such as islets can increase 100-fold, and that constitutively expressed ectopic hyperleptinemia depletes TG, suggest that leptin controls the homeostatic system for intracellular TG. The fact that the function and viability of nonadipocytes is compromised when their TG content rises above or falls below the normal range suggests that normal homeostasis of their intracellular TG is critical for optimal function and to prevent lipoapoptosis. Thus far, lipotoxic diabetes of fa/fa Zucker diabetic fatty rats is the only proven lipodegenerative disease, but the possibility of lipotoxic disease of skeletal and/or cardiac muscle may require investigation, as does the possible influence of the intracellular TG content on autoimmune and neoplastic processes.  (+info)

(7/10340) Reversing adipocyte differentiation: implications for treatment of obesity.

Conventional treatment of obesity reduces fat in mature adipocytes but leaves them with lipogenic enzymes capable of rapid resynthesis of fat, a likely factor in treatment failure. Adenovirus-induced hyperleptinemia in normal rats results in rapid nonketotic fat loss that persists after hyperleptinemia disappears, whereas pair-fed controls regain their weight in 2 weeks. We report here that the hyperleptinemia depletes adipocyte fat while profoundly down-regulating lipogenic enzymes and their transcription factor, peroxisome proliferator-activated receptor (PPAR)gamma in epididymal fat; enzymes of fatty acid oxidation and their transcription factor, PPARalpha, normally low in adipocytes, are up-regulated, as are uncoupling proteins 1 and 2. This transformation of adipocytes from cells that store triglycerides to fatty acid-oxidizing cells is accompanied by loss of the adipocyte markers, adipocyte fatty acid-binding protein 2, tumor necrosis factor alpha, and leptin, and by the appearance of the preadipocyte marker Pref-1. These findings suggest a strategy for the treatment of obesity by alteration of the adipocyte phenotype.  (+info)

(8/10340) Screening of Korean forest plants for rat lens aldose reductase inhibition.

Naturally occurring substances which can prevent and treat diabetic complications were sought by examining ethanol extracts prepared from Korean forest plants for their inhibitory effects on rat lens aldose reductase activity in vitro. Among the plants examined, Acer ginnala, Illicium religiosum and Cornus macrophylla exerted the most strong inhibitory activity on aldose reductase.  (+info)


http://answers.yahooapis.com/AnswersService/V1/questionSearch?appid=NICVDSTIkY0W874J7FBwoDOhZQhmwbnmxyufdDIDGMo-&output=json&results=50&query=Diabetes+OR+Mellitus®ion=us®ion=uk®ion=sg®ion=ca®ion=au®ion=in&category_id=396545144&category_id=396545367&category_id=396546046&category_id=396545018